eF-site ID 2z8n-A PDB Code 2z8n Chain A click to enlarge Title Structural basis for the catalytic mechanism of phosphothreonine lyase Classification LYASE Compound 27.5 kDa virulence protein Source null (VRP3_SALTY) Sequence A:  PSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPDYSGMRQ SGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAGDKFH ISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQ ARVSLGAQFTLYIKPDQENSQYSASFLHKTRQFIECLESR LSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGEMQ RQALREEPFYRLMTE Description Functional site 1) chain A residue 104 type sequence K description BINDING SITE FOR RESIDUE SO4 A 300 source : AC1 2) chain A residue 106 type sequence H description BINDING SITE FOR RESIDUE SO4 A 300 source : AC1 3) chain A residue 148 type sequence R description BINDING SITE FOR RESIDUE SO4 A 300 source : AC1 4) chain A residue 213 type sequence R description BINDING SITE FOR RESIDUE SO4 A 300 source : AC1 5) chain A residue 220 type sequence R description BINDING SITE FOR RESIDUE SO4 A 300 source : AC1 6) chain A residue 224 type sequence E description BINDING SITE FOR RESIDUE SO4 A 301 source : AC2 7) chain A residue 227 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC2 8) chain A residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC2 9) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE SO4 A 302 source : AC3 10) chain A residue 223 type sequence G description BINDING SITE FOR RESIDUE SO4 B 304 source : AC8 11) chain A residue 224 type sequence E description BINDING SITE FOR RESIDUE SO4 B 304 source : AC8 12) chain A residue 225 type sequence M description BINDING SITE FOR RESIDUE SO4 B 304 source : AC8 13) chain A residue 226 type sequence Q description BINDING SITE FOR RESIDUE SO4 B 304 source : AC8 14) chain A residue 106 type ACT_SITE sequence H description Proton donor source Swiss-Prot : SWS_FT_FI1 15) chain A residue 136 type ACT_SITE sequence K description Proton acceptor source Swiss-Prot : SWS_FT_FI2

Display surface Download Links