eF-site ID 2z8a-AB PDB Code 2z8a Chain A, B click to enlarge Title Ligand Migration and Binding in The Dimeric Hemoglobin of Scapharca Inaequivalvis: I25W with CO Bound to HEME and in the Presence of 3 Atoms of XE Classification OXYGEN BINDING Compound Globin-1 Source Anadara inaequivalvis (Inequivalve ark) (Scapharca inaequivalvis) (GLB1_SCAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL B:  PSVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTL FADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNF IDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKK VLASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain B residue 2011 type sequence T description BINDING SITE FOR RESIDUE PO4 B 5402 source : AC1 2) chain B residue 2013 type sequence D description BINDING SITE FOR RESIDUE PO4 B 5402 source : AC1 3) chain A residue 1050 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 4) chain A residue 1051 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 5) chain A residue 1053 type sequence R description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 6) chain A residue 1069 type sequence H description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 7) chain A residue 1073 type sequence L description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 8) chain A residue 1077 type sequence L description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 9) chain A residue 1097 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 10) chain A residue 1100 type sequence N description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 11) chain A residue 1101 type sequence H description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 12) chain A residue 1104 type sequence R description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 13) chain A residue 1110 type sequence E description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 14) chain A residue 1111 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 15) chain B residue 2096 type sequence K description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 16) chain B residue 2100 type sequence N description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 17) chain A residue 1096 type sequence K description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 18) chain A residue 1100 type sequence N description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 19) chain B residue 2050 type sequence Y description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 20) chain B residue 2051 type sequence F description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 21) chain B residue 2053 type sequence R description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 22) chain B residue 2069 type sequence H description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 23) chain B residue 2073 type sequence L description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 24) chain B residue 2097 type sequence F description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 25) chain B residue 2100 type sequence N description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 26) chain B residue 2101 type sequence H description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 27) chain B residue 2104 type sequence R description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 28) chain B residue 2110 type sequence E description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 29) chain B residue 2111 type sequence F description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 30) chain A residue 1037 type sequence M description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 31) chain A residue 1051 type sequence F description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 32) chain A residue 1069 type sequence H description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 33) chain A residue 1073 type sequence L description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 34) chain B residue 2037 type sequence M description BINDING SITE FOR RESIDUE CMO B 2148 source : AC5 35) chain B residue 2051 type sequence F description BINDING SITE FOR RESIDUE CMO B 2148 source : AC5 36) chain B residue 2069 type sequence H description BINDING SITE FOR RESIDUE CMO B 2148 source : AC5 37) chain B residue 2073 type sequence L description BINDING SITE FOR RESIDUE CMO B 2148 source : AC5 38) chain B residue 2077 type sequence L description BINDING SITE FOR RESIDUE XE B 5502 source : AC6 39) chain A residue 1097 type sequence F description BINDING SITE FOR RESIDUE XE A 5505 source : AC7 40) chain A residue 1111 type sequence F description BINDING SITE FOR RESIDUE XE A 5505 source : AC7 41) chain B residue 2097 type sequence F description BINDING SITE FOR RESIDUE XE B 5506 source : AC8 42) chain B residue 2111 type sequence F description BINDING SITE FOR RESIDUE XE B 5506 source : AC8 43) chain A residue 1101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1 44) chain B residue 2101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links