eF-site ID 2z8a-A PDB Code 2z8a Chain A click to enlarge Title Ligand Migration and Binding in The Dimeric Hemoglobin of Scapharca Inaequivalvis: I25W with CO Bound to HEME and in the Presence of 3 Atoms of XE Classification OXYGEN BINDING Compound Globin-1 Source Anadara inaequivalvis (Inequivalve ark) (Scapharca inaequivalvis) (GLB1_SCAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain A residue 1050 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 2) chain A residue 1051 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 3) chain A residue 1053 type sequence R description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 4) chain A residue 1069 type sequence H description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 5) chain A residue 1073 type sequence L description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 6) chain A residue 1077 type sequence L description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 7) chain A residue 1097 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 8) chain A residue 1100 type sequence N description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 9) chain A residue 1101 type sequence H description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 10) chain A residue 1104 type sequence R description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 11) chain A residue 1110 type sequence E description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 12) chain A residue 1111 type sequence F description BINDING SITE FOR RESIDUE HEM A 1147 source : AC2 13) chain A residue 1096 type sequence K description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 14) chain A residue 1100 type sequence N description BINDING SITE FOR RESIDUE HEM B 2147 source : AC3 15) chain A residue 1037 type sequence M description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 16) chain A residue 1051 type sequence F description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 17) chain A residue 1069 type sequence H description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 18) chain A residue 1073 type sequence L description BINDING SITE FOR RESIDUE CMO A 1148 source : AC4 19) chain A residue 1097 type sequence F description BINDING SITE FOR RESIDUE XE A 5505 source : AC7 20) chain A residue 1111 type sequence F description BINDING SITE FOR RESIDUE XE A 5505 source : AC7 21) chain A residue 1101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links