eF-site ID 2z7e-A PDB Code 2z7e Chain A click to enlarge Title Crystal structure of Aquifex aeolicus IscU with bound [2Fe-2S] cluster Classification BIOSYNTHETIC PROTEIN Compound NifU-like protein Source Aquifex aeolicus (NIFU_AQUAE) Sequence A:  MSFEYNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAM LFTIKVNPENDVIEDVRFKTFGCGSAIAVSSMLTEMVKGK PIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIK DYLMKQGRVEEASKIPDCY Description Functional site 1) chain A residue 105 type sequence I description BINDING SITE FOR RESIDUE SO4 A 158 source : AC1 2) chain A residue 106 type sequence H description BINDING SITE FOR RESIDUE SO4 A 158 source : AC1 3) chain A residue 107 type sequence C description BINDING SITE FOR RESIDUE SO4 A 158 source : AC1 4) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE SO4 A 159 source : AC2 5) chain A residue 22 type sequence L description BINDING SITE FOR RESIDUE SO4 A 159 source : AC2 6) chain A residue 23 type sequence E description BINDING SITE FOR RESIDUE SO4 A 159 source : AC2 7) chain A residue 57 type sequence R description BINDING SITE FOR RESIDUE SO4 A 159 source : AC2 8) chain A residue 18 type sequence N description BINDING SITE FOR RESIDUE SO4 A 160 source : AC3 9) chain A residue 36 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P0DMG2, ECO:0000269|PubMed:18723024 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 63 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P0DMG2, ECO:0000269|PubMed:18723024 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 106 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P0DMG2, ECO:0000269|PubMed:18723024 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 107 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P0DMG2, ECO:0000269|PubMed:18723024 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links