eF-site ID 2z0p-A PDB Code 2z0p Chain A click to enlarge Title Crystal structure of PH domain of Bruton's tyrosine kinase Classification SIGNALING PROTEIN Compound Tyrosine-protein kinase BTK Source Homo sapiens (Human) (BTK_HUMAN) Sequence A:  AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYE YDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIME QISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKN VIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL Description Functional site 1) chain A residue 143 type sequence H description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 2) chain A residue 154 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 3) chain A residue 155 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 4) chain A residue 165 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 5) chain A residue 12 type sequence K description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 6) chain A residue 14 type sequence S description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 7) chain A residue 15 type sequence Q description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 8) chain A residue 16 type sequence Q description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 9) chain A residue 17 type sequence K description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 10) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 11) chain A residue 21 type sequence S description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 12) chain A residue 22 type sequence P description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 13) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 14) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 15) chain A residue 28 type sequence R description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 16) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 17) chain A residue 53 type sequence K description BINDING SITE FOR RESIDUE 4PT A 501 source : AC5 18) chain A residue 26 type BINDING sequence K description BINDING => ECO:0000269|PubMed:10196129 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 28 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10196129 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 39 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:10196129 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 53 type BINDING sequence K description BINDING => ECO:0000269|PubMed:10196129 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 21 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:16644721 source Swiss-Prot : SWS_FT_FI4 23) chain A residue 115 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:16644721 source Swiss-Prot : SWS_FT_FI4 24) chain A residue 143 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00432, ECO:0000269|PubMed:10196129, ECO:0000269|PubMed:9218782, ECO:0000269|Ref.48 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 154 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00432, ECO:0000269|PubMed:10196129, ECO:0000269|PubMed:9218782, ECO:0000269|Ref.48 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 155 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00432, ECO:0000269|PubMed:10196129, ECO:0000269|PubMed:9218782, ECO:0000269|Ref.48 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 165 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00432, ECO:0000269|PubMed:10196129, ECO:0000269|PubMed:9218782, ECO:0000269|Ref.48 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 2 type MOD_RES sequence A description N-acetylalanine => ECO:0000269|Ref.11, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 40 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P35991 source Swiss-Prot : SWS_FT_FI5 30) chain A residue 55 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links