eF-site ID 2yww-AB PDB Code 2yww Chain A, B click to enlarge Title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii Classification METAL BINDING PROTEIN Compound Aspartate carbamoyltransferase regulatory chain Source null (PYRI_METJA) Sequence A:  KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINV PSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRN GKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIE SKNPLKIRCYYCEKFLNEVIF B:  KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINV PSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRN GKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIE SKNPLKIRCYYCEKFLNEVIFE Description Functional site 1) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain B residue 108 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC3 3) chain B residue 113 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC3 4) chain B residue 136 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC3 5) chain B residue 139 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC3 6) chain A residue 108 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 7) chain A residue 113 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 8) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 9) chain A residue 139 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 10) chain B residue 11 type sequence K description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 11) chain B residue 12 type sequence I description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 12) chain B residue 17 type sequence V description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 13) chain B residue 19 type sequence D description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 14) chain B residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 15) chain B residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 16) chain B residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 17) chain B residue 85 type sequence I description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 18) chain B residue 88 type sequence G description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 19) chain B residue 90 type sequence V description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 20) chain B residue 93 type sequence K description BINDING SITE FOR RESIDUE ATP B 400 source : AC5 21) chain A residue 9 type sequence V description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 22) chain A residue 10 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 23) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 24) chain B residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 25) chain B residue 42 type sequence M description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 26) chain B residue 47 type sequence V description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 27) chain B residue 48 type sequence P description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 28) chain B residue 49 type sequence S description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 29) chain B residue 50 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 30) chain B residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 31) chain B residue 55 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 32) chain B residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 33) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 34) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 35) chain A residue 47 type sequence V description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 36) chain A residue 48 type sequence P description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 37) chain A residue 49 type sequence S description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 38) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 39) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 40) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 41) chain A residue 57 type sequence I description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 42) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 43) chain B residue 9 type sequence V description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 44) chain B residue 10 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 45) chain A residue 11 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 46) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 47) chain A residue 17 type sequence V description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 48) chain A residue 19 type sequence D description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 49) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 50) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 51) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 52) chain A residue 88 type sequence G description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 53) chain A residue 90 type sequence V description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 54) chain A residue 93 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 55) chain B residue 129 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 56) chain B residue 108 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 57) chain B residue 113 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 58) chain B residue 136 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 59) chain B residue 139 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 60) chain A residue 108 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 61) chain A residue 113 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 62) chain A residue 136 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 63) chain A residue 139 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links