eF-site ID 2yww-A PDB Code 2yww Chain A click to enlarge Title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii Classification METAL BINDING PROTEIN Compound Aspartate carbamoyltransferase regulatory chain Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (PYRI_METJA) Sequence A:  KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINV PSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRN GKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIE SKNPLKIRCYYCEKFLNEVIF Description Functional site 1) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 108 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 3) chain A residue 113 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 4) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 5) chain A residue 139 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 6) chain A residue 9 type sequence V description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 7) chain A residue 10 type sequence K description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 8) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE ATP B 401 source : AC6 9) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 10) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 11) chain A residue 47 type sequence V description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 12) chain A residue 48 type sequence P description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 13) chain A residue 49 type sequence S description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 14) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 15) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 16) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 17) chain A residue 57 type sequence I description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 18) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP A 402 source : AC7 19) chain A residue 11 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 20) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 21) chain A residue 17 type sequence V description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 22) chain A residue 19 type sequence D description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 23) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 24) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 25) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 26) chain A residue 88 type sequence G description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 27) chain A residue 90 type sequence V description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 28) chain A residue 93 type sequence K description BINDING SITE FOR RESIDUE ATP A 403 source : AC8 29) chain A residue 108 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 113 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 136 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 139 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links