eF-site ID 2ytw_4-A
PDB Code 2ytw
Model 4
Chain A

click to enlarge
Title Solution structure of the PDZ-domain of human protease HTRA 1 precursor
Classification STRUCTURAL PROTEIN
Compound Serine protease HTRA1
Source Homo sapiens (Human) (HTRA1_HUMAN)
Sequence A:  GSSGSSGRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRH
RDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSV
VSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
Description (1)  Serine protease HTRA1 (E.C.3.4.21.-)

Display surface

Download
Links