eF-site ID 2yiu-E PDB Code 2yiu Chain E click to enlarge Title X-ray structure of the dimeric cytochrome BC1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution Classification OXIDOREDUCTASE Compound CYTOCHROME B Source ORGANISM_SCIENTIFIC: PARACOCCUS DENITRIFICANS; Sequence E:  DISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPL RTLADEGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTD HFPTVSGEGMGPDLSLMAKARIGGPEYIHAVLTGYDGEEK VLYHNAAFAGNWIQMAAPLSDDQVTYEDGTPATVDQMATD VAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKK LWQPIK Description Functional site 1) chain E residue 81 type sequence V description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 2) chain E residue 82 type sequence C description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 3) chain E residue 85 type sequence C description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 4) chain E residue 86 type sequence H description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 5) chain E residue 154 type sequence R description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 6) chain E residue 177 type sequence Y description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 7) chain E residue 203 type sequence F description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 8) chain E residue 209 type sequence Q description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 9) chain E residue 210 type sequence M description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 10) chain E residue 213 type sequence P description BINDING SITE FOR RESIDUE HEC E 500 source : AC9 11) chain E residue 210 type BINDING sequence M description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI4 12) chain E residue 86 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI3

Display surface Download Links