eF-site ID 2yht-L
PDB Code 2yht
Chain L

click to enlarge
Title Crystal structure of Hfq riboregulator from E. coli (P1 space group)
Classification CHAPERONE
Compound PROTEIN HFQ
Source (HFQ_ECOLI)
Sequence L:  SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
LKNTVSQMVYKHAISTVVPSRPV
Description (1)  PROTEIN HFQ

Display surface

Download
Links