eF-site ID 2yho-G PDB Code 2yho Chain G click to enlarge Title The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor Classification LIGASE Compound E3 UBIQUITIN-PROTEIN LIGASE MYLIP Source Homo sapiens (Human) (UB2D1_HUMAN) Sequence G:  RVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESC AAQLQSCPVCRSRVEHVQHVYLPTHTSLLN Description Functional site 1) chain G residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN G 1001 source : AC7 2) chain G residue 390 type sequence C description BINDING SITE FOR RESIDUE ZN G 1001 source : AC7 3) chain G residue 408 type sequence C description BINDING SITE FOR RESIDUE ZN G 1001 source : AC7 4) chain G residue 411 type sequence C description BINDING SITE FOR RESIDUE ZN G 1001 source : AC7 5) chain G residue 402 type sequence C description BINDING SITE FOR RESIDUE ZN G 1002 source : AC8 6) chain G residue 404 type sequence H description BINDING SITE FOR RESIDUE ZN G 1002 source : AC8 7) chain G residue 418 type sequence C description BINDING SITE FOR RESIDUE ZN G 1002 source : AC8 8) chain G residue 421 type sequence C description BINDING SITE FOR RESIDUE ZN G 1002 source : AC8 9) chain G residue 383 type sequence E description BINDING SITE FOR RESIDUE ACT G 1442 source : BC1 10) chain G residue 384 type sequence A description BINDING SITE FOR RESIDUE ACT G 1442 source : BC1 11) chain G residue 386 type sequence L description BINDING SITE FOR RESIDUE ACT G 1442 source : BC1 12) chain G residue 388 type sequence M description BINDING SITE FOR RESIDUE ACT G 1442 source : BC1

Display surface Download Links