eF-site ID 2yho-E PDB Code 2yho Chain E click to enlarge Title The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor Classification LIGASE Compound E3 UBIQUITIN-PROTEIN LIGASE MYLIP Source Homo sapiens (Human) (UB2D1_HUMAN) Sequence E:  RVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESC AAQLQSCPVCRSRVEHVQHVYLPTHTSLLN Description Functional site 1) chain E residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN E 1001 source : AC5 2) chain E residue 390 type sequence C description BINDING SITE FOR RESIDUE ZN E 1001 source : AC5 3) chain E residue 408 type sequence C description BINDING SITE FOR RESIDUE ZN E 1001 source : AC5 4) chain E residue 411 type sequence C description BINDING SITE FOR RESIDUE ZN E 1001 source : AC5 5) chain E residue 402 type sequence C description BINDING SITE FOR RESIDUE ZN E 1002 source : AC6 6) chain E residue 404 type sequence H description BINDING SITE FOR RESIDUE ZN E 1002 source : AC6 7) chain E residue 418 type sequence C description BINDING SITE FOR RESIDUE ZN E 1002 source : AC6 8) chain E residue 421 type sequence C description BINDING SITE FOR RESIDUE ZN E 1002 source : AC6

Display surface Download Links