eF-site ID 2yhn-A PDB Code 2yhn Chain A click to enlarge Title The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor Classification LIGASE Compound E3 UBIQUITIN-PROTEIN LIGASE MYLIP Source Homo sapiens (Human) (MYLIP_HUMAN) Sequence A:  VLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCA AQLQSCPVCRSRVEHVQHVYLPTH Description Functional site 1) chain A residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 2) chain A residue 390 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 3) chain A residue 408 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 4) chain A residue 411 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 5) chain A residue 402 type sequence C description BINDING SITE FOR RESIDUE ZN A 1002 source : AC2 6) chain A residue 404 type sequence H description BINDING SITE FOR RESIDUE ZN A 1002 source : AC2 7) chain A residue 418 type sequence C description BINDING SITE FOR RESIDUE ZN A 1002 source : AC2 8) chain A residue 421 type sequence C description BINDING SITE FOR RESIDUE ZN A 1002 source : AC2 9) chain A residue 387-422 type ZN_FING sequence CMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCR description RING-type => ECO:0000255|PROSITE-ProRule:PRU00175 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links