eF-site ID 2y5b-E PDB Code 2y5b Chain E click to enlarge Title Structure of USP21 in complex with linear diubiquitin-aldehyde Classification PROTEIN BINDING/HYDROLASE Compound UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21 Source Homo sapiens (Human) (UBB_HUMAN) Sequence E:  HHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFCL RRDFRQERAQELTEAFADVIGALWHPDSCEAVNPTRFRAV FQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGEEPEL SDDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGY RSTTFEVFCDLSLPIPKGKVSLRDCFNLFTKEEELESENA PVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIK KSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSV HYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLF YQLMQ Description Functional site 1) chain E residue 235 type sequence P description BINDING SITE FOR RESIDUE SO4 E 1560 source : AC4 2) chain E residue 369 type sequence K description BINDING SITE FOR RESIDUE SO4 E 1560 source : AC4 3) chain E residue 457 type sequence R description BINDING SITE FOR RESIDUE SO4 E 1560 source : AC4 4) chain E residue 276 type sequence E description BINDING SITE FOR RESIDUE SO4 E 1561 source : AC5 5) chain E residue 277 type sequence A description BINDING SITE FOR RESIDUE SO4 E 1561 source : AC5 6) chain E residue 320 type sequence R description BINDING SITE FOR RESIDUE SO4 E 1562 source : AC9 7) chain E residue 296 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1564 source : BC1 8) chain E residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN E 1000 source : BC5 9) chain E residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN E 1000 source : BC5 10) chain E residue 437 type sequence C description BINDING SITE FOR RESIDUE ZN E 1000 source : BC5 11) chain E residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN E 1000 source : BC5 12) chain E residue 384 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 13) chain E residue 387 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 14) chain E residue 437 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 15) chain E residue 440 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links