eF-site ID 2y5b-A PDB Code 2y5b Chain A click to enlarge Title Structure of USP21 in complex with linear diubiquitin-aldehyde Classification PROTEIN BINDING/HYDROLASE Compound UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21 Source Homo sapiens (Human) (UBB_HUMAN) Sequence A:  HTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLR RDFRQEVRAQELTEAFADVIGALWHPDSCEAVNPTRFRAV FQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRSDDDRA NLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFE VFCDLSLPIPKKKVSLRDCFNLFTKEEELESENAPVCDRC RQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV DFPLQRLSLGDFASDSPVYQLYALCNHSGSVHYGHYTALC RCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLM Description Functional site 1) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 2) chain A residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 3) chain A residue 437 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 4) chain A residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 5) chain A residue 472 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1559 source : AC2 6) chain A residue 473 type sequence I description BINDING SITE FOR RESIDUE SO4 A 1559 source : AC2 7) chain A residue 474 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1560 source : AC3 8) chain A residue 475 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1560 source : AC3 9) chain A residue 513 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1560 source : AC3 10) chain A residue 514 type sequence V description BINDING SITE FOR RESIDUE SO4 A 1560 source : AC3 11) chain A residue 320 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1561 source : AC6 12) chain A residue 235 type sequence P description BINDING SITE FOR RESIDUE SO4 A 1562 source : AC7 13) chain A residue 369 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1562 source : AC7 14) chain A residue 457 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1562 source : AC7 15) chain A residue 483 type sequence P description BINDING SITE FOR RESIDUE SO4 A 1563 source : AC8 16) chain A residue 484 type sequence L description BINDING SITE FOR RESIDUE SO4 A 1563 source : AC8 17) chain A residue 485 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 1563 source : AC8 18) chain A residue 541 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1564 source : BC1 19) chain A residue 543 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1564 source : BC1 20) chain A residue 515 type sequence H description BINDING SITE FOR RESIDUE SO4 B 1152 source : BC2 21) chain A residue 215 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1565 source : BC4 22) chain A residue 216 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1565 source : BC4 23) chain A residue 390 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1565 source : BC4 24) chain A residue 534 type sequence D description BINDING SITE FOR RESIDUE SO4 A 1565 source : BC4 25) chain A residue 535 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1565 source : BC4 26) chain A residue 213-228 type prosite sequence GLRNLGNTCFLNAVLQ description USP_1 Ubiquitin specific protease (USP) domain signature 1. GLrnlGNtCFLNAvLQ source prosite : PS00972 27) chain A residue 502-519 type prosite sequence YQLYALCNHSGSVHYGHY description USP_2 Ubiquitin specific protease (USP) domain signature 2. YqLyALcnHsGsvhy..GHY source prosite : PS00973 28) chain A residue 437 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 440 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links