eF-site ID 2y1n-A PDB Code 2y1n Chain A click to enlarge Title Structure of c-Cbl-ZAP-70 peptide complex Classification LIGASE/TRANSFERASE Compound E3 UBIQUITIN-PROTEIN LIGASE Source null (ZAP70_HUMAN) Sequence A:  DKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDT YQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTIS LFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPS GLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHE VHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPW SSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSY IFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDG FREGFYLFPDGRNQNPDLTGLCEKVTQEQYELYCEMGSTF QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPF CRCEIKGTEPIVVDPFD Description Functional site 1) chain A residue 381 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 2) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 3) chain A residue 401 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 4) chain A residue 404 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 5) chain A residue 396 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 6) chain A residue 398 type sequence H description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 7) chain A residue 416 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 8) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 9) chain A residue 229 type sequence D description BINDING SITE FOR RESIDUE CA A 1438 source : AC5 10) chain A residue 231 type sequence T description BINDING SITE FOR RESIDUE CA A 1438 source : AC5 11) chain A residue 233 type sequence N description BINDING SITE FOR RESIDUE CA A 1438 source : AC5 12) chain A residue 235 type sequence Y description BINDING SITE FOR RESIDUE CA A 1438 source : AC5 13) chain A residue 240 type sequence E description BINDING SITE FOR RESIDUE CA A 1438 source : AC5 14) chain A residue 396-405 type prosite sequence CGHLMCTSCL description ZF_RING_1 Zinc finger RING-type signature. CgHlMCtsCL source prosite : PS00518 15) chain A residue 233 type MOD_RES sequence N description Phosphotyrosine => ECO:0000269|PubMed:8943331, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 235 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:8943331, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 240 type MOD_RES sequence E description Phosphotyrosine => ECO:0000269|PubMed:8943331, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 371 type MOD_RES sequence Y description Phosphotyrosine; by INSR => ECO:0000269|PubMed:11997497 source Swiss-Prot : SWS_FT_FI4 19) chain A residue 294 type BINDING sequence R description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links