eF-site ID 2y0b-A PDB Code 2y0b Chain A click to enlarge Title Caspase-3 in Complex with an Inhibitory DARPin-3.4_S76R Classification HYDROLASE/PROTEIN BINDING Compound CASPASE-3 SUBUNIT P17 Source (2Y0B) Sequence A:  DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAAN LRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSS FVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTG KPKLFIIQAXRGTELDCGIET Description Functional site 1) chain A residue 88 type sequence K description BINDING SITE FOR RESIDUE MPD A 1175 source : AC1 2) chain A residue 89 type sequence N description BINDING SITE FOR RESIDUE MPD A 1175 source : AC1 3) chain A residue 90 type sequence D description BINDING SITE FOR RESIDUE MPD A 1175 source : AC1 4) chain A residue 91 type sequence L description BINDING SITE FOR RESIDUE MPD A 1175 source : AC1 5) chain A residue 65 type sequence S description BINDING SITE FOR RESIDUE MPD B 1278 source : AC2 6) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE MRD A 1176 source : AC4 7) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE MRD A 1176 source : AC4 8) chain A residue 71 type sequence A description BINDING SITE FOR RESIDUE MRD A 1176 source : AC4 9) chain A residue 87 type sequence N description BINDING SITE FOR RESIDUE MRD A 1176 source : AC4 10) chain A residue 89 type sequence N description BINDING SITE FOR RESIDUE MRD A 1176 source : AC4 11) chain A residue 62 type catalytic sequence T description 815 source MCSA : MCSA1 12) chain A residue 63 type catalytic sequence S description 815 source MCSA : MCSA1 13) chain A residue 121 type catalytic sequence H description 815 source MCSA : MCSA1 14) chain A residue 122 type catalytic sequence G description 815 source MCSA : MCSA1 15) chain A residue 163 type catalytic sequence X description 815 source MCSA : MCSA1 16) chain A residue 108-122 type prosite sequence HSKRSSFVCVLLSHG description CASPASE_HIS Caspase family histidine active site. HskrsSfvCvLLSHG source prosite : PS01121 17) chain A residue 154-165 type prosite sequence KPKLFIIQAXRG description CASPASE_CYS Caspase family cysteine active site. KPKLFIIQACRG source prosite : PS01122 18) chain A residue 163 type MOD_RES sequence X description S-nitrosocysteine; in inhibited form => ECO:0000269|PubMed:10213689 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links