eF-site ID 2y03-A PDB Code 2y03 Chain A click to enlarge Title TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND AGONIST ISOPRENALINE Classification RECEPTOR Compound BETA-1 ADRENERGIC RECEPTOR Source (ADRB1_MELGA) Sequence A:  AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRL QTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSF LCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKC YQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYR EAKEQIRSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVN IVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFR KAFKRLLA Description Functional site 1) chain A residue 130 type sequence E description BINDING SITE FOR RESIDUE Y01 A 401 source : AC1 2) chain A residue 157 type sequence R description BINDING SITE FOR RESIDUE Y01 A 401 source : AC1 3) chain A residue 161 type sequence I description BINDING SITE FOR RESIDUE Y01 A 401 source : AC1 4) chain A residue 164 type sequence T description BINDING SITE FOR RESIDUE Y01 A 401 source : AC1 5) chain A residue 180 type sequence H description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 6) chain A residue 181 type sequence W description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 7) chain A residue 184 type sequence D description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 8) chain A residue 185 type sequence E description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 9) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 10) chain A residue 206 type sequence A description BINDING SITE FOR RESIDUE 2CV A 501 source : AC2 11) chain A residue 230 type sequence V description BINDING SITE FOR RESIDUE 2CV A 502 source : AC3 12) chain A residue 293 type sequence G description BINDING SITE FOR RESIDUE 2CV A 502 source : AC3 13) chain A residue 205 type sequence R description BINDING SITE FOR RESIDUE 2CV A 503 source : AC4 14) chain A residue 315 type sequence F description BINDING SITE FOR RESIDUE 2CV A 503 source : AC4 15) chain A residue 121 type sequence D description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 16) chain A residue 211 type sequence S description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 17) chain A residue 215 type sequence S description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 18) chain A residue 306 type sequence F description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 19) chain A residue 307 type sequence F description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 20) chain A residue 329 type sequence N description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 21) chain A residue 333 type sequence Y description BINDING SITE FOR RESIDUE 5FW A 601 source : AC5 22) chain A residue 192 type sequence C description BINDING SITE FOR RESIDUE NA A 701 source : AC6 23) chain A residue 193 type sequence Y description BINDING SITE FOR RESIDUE NA A 701 source : AC6 24) chain A residue 195 type sequence D description BINDING SITE FOR RESIDUE NA A 701 source : AC6 25) chain A residue 198 type sequence C description BINDING SITE FOR RESIDUE NA A 701 source : AC6 26) chain A residue 206 type sequence A description BINDING SITE FOR RESIDUE Y01 B 401 source : AC7 27) chain A residue 160 type sequence V description BINDING SITE FOR RESIDUE 2CV B 501 source : AC8 28) chain A residue 164 type sequence T description BINDING SITE FOR RESIDUE 2CV B 501 source : AC8 29) chain A residue 157 type sequence R description BINDING SITE FOR RESIDUE 2CV B 503 source : BC1 30) chain A residue 68-76 type TOPO_DOM sequence STQRLQTLT description Cytoplasmic => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 138-155 type TOPO_DOM sequence DRYLAITSPFRYQSLMTR description Cytoplasmic => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 232-313 type TOPO_DOM sequence REAKEQIRSRVMLMREHKALKTLGIIMGVFTLCWLPFFLV NIVN description Cytoplasmic => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 104-115 type TOPO_DOM sequence RGTWLWGSFLCE description Extracellular => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI4 34) chain A residue 180-205 type TOPO_DOM sequence HWWRDEDPQALKCYQDPGCCDFVTNR description Extracellular => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI4 35) chain A residue 344-348 type TOPO_DOM sequence CRSPD description Extracellular => ECO:0000269|PubMed:18594507 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 121 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18594507, ECO:0007744|PDB:2VT4 source Swiss-Prot : SWS_FT_FI10 37) chain A residue 211 type BINDING sequence S description BINDING => ECO:0000269|PubMed:18594507, ECO:0007744|PDB:2VT4 source Swiss-Prot : SWS_FT_FI10 38) chain A residue 357 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18594507, ECO:0007744|PDB:2VT4 source Swiss-Prot : SWS_FT_FI10 39) chain A residue 127-143 type prosite sequence ASIETLCVIAIDRYLAI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. ASIeTLCVIAIDRYLaI source prosite : PS00237 40) chain A residue 39-67 type TRANSMEM sequence QWEAGMSLLMALVVLLIVAGNVLVIAAIG description Helical; Name=1 source Swiss-Prot : SWS_FT_FI1 41) chain A residue 77-103 type TRANSMEM sequence NLFITSLACADLVVGLLVVPFGATLVV description Helical; Name=2 source Swiss-Prot : SWS_FT_FI3 42) chain A residue 116-137 type TRANSMEM sequence LWTSLDVLCVTASIETLCVIAI description Helical; Name=3 source Swiss-Prot : SWS_FT_FI5 43) chain A residue 156-179 type TRANSMEM sequence ARAKVIICTVWAISALVSFLPIMM description Helical; Name=4 source Swiss-Prot : SWS_FT_FI6 44) chain A residue 206-231 type TRANSMEM sequence AYAIASSIISFYIPLLIMIFVALRVY description Helical; Name=5 source Swiss-Prot : SWS_FT_FI7 45) chain A residue 314-343 type TRANSMEM sequence VFNRDLVPDWLFVAFNWLGYANSAMNPIIY description Helical; Name=6 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links