eF-site ID 2y02-AB
PDB Code 2y02
Chain A, B

click to enlarge
Title TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND AGONIST CARMOTEROL
Classification RECEPTOR
Compound BETA-1 ADRENERGIC RECEPTOR
Source Meleagris gallopavo (Common turkey) (ADRB1_MELGA)
Sequence A:  AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRL
QTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSF
LCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL
MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKC
YQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYR
EAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIV
NVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKA
FKRLLA
B:  AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRL
QTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSF
LCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL
MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKC
YQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYR
EAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGVFT
LCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNP
IIYCRSPDFRKAFKRLLA
Description (1)  BETA-1 ADRENERGIC RECEPTOR


Functional site

1) chain A
residue 192
type
ligand
sequence C
description BINDING SITE FOR RESIDUE NA A 701
source : AC1

2) chain A
residue 193
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NA A 701
source : AC1

3) chain A
residue 195
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA A 701
source : AC1

4) chain A
residue 198
type
ligand
sequence C
description BINDING SITE FOR RESIDUE NA A 701
source : AC1

5) chain A
residue 130
type
ligand
sequence E
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

6) chain A
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

7) chain A
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

8) chain A
residue 161
type
ligand
sequence I
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

9) chain A
residue 164
type
ligand
sequence T
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

10) chain A
residue 214
type
ligand
sequence I
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

11) chain B
residue 205
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

12) chain B
residue 206
type
ligand
sequence A
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

13) chain B
residue 210
type
ligand
sequence A
description BINDING SITE FOR RESIDUE Y01 A 401
source : AC2

14) chain A
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE Y01 A 402
source : AC3

15) chain A
residue 85
type
ligand
sequence C
description BINDING SITE FOR RESIDUE Y01 A 402
source : AC3

16) chain A
residue 155
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 A 402
source : AC3

17) chain A
residue 159
type
ligand
sequence K
description BINDING SITE FOR RESIDUE Y01 A 402
source : AC3

18) chain A
residue 166
type
ligand
sequence W
description BINDING SITE FOR RESIDUE Y01 A 402
source : AC3

19) chain A
residue 181
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

20) chain A
residue 184
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

21) chain A
residue 185
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

22) chain A
residue 204
type
ligand
sequence N
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

23) chain A
residue 206
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

24) chain B
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

25) chain B
residue 164
type
ligand
sequence T
description BINDING SITE FOR RESIDUE 2CV A 501
source : AC4

26) chain A
residue 227
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 2CV A 502
source : AC5

27) chain A
residue 289
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 2CV A 502
source : AC5

28) chain A
residue 205
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV A 503
source : AC6

29) chain A
residue 315
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 2CV A 503
source : AC6

30) chain B
residue 148
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV A 503
source : AC6

31) chain B
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV A 503
source : AC6

32) chain A
residue 51
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV A 504
source : AC7

33) chain A
residue 326
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV A 504
source : AC7

34) chain A
residue 334
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 2CV A 504
source : AC7

35) chain A
residue 338
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 2CV A 504
source : AC7

36) chain A
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV A 505
source : AC8

37) chain A
residue 163
type
ligand
sequence C
description BINDING SITE FOR RESIDUE 2CV A 505
source : AC8

38) chain B
residue 185
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 2CV A 505
source : AC8

39) chain A
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

40) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

41) chain A
residue 200
type
ligand
sequence D
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

42) chain A
residue 201
type
ligand
sequence F
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

43) chain A
residue 208
type
ligand
sequence A
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

44) chain A
residue 211
type
ligand
sequence S
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

45) chain A
residue 215
type
ligand
sequence S
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

46) chain A
residue 306
type
ligand
sequence F
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

47) chain A
residue 307
type
ligand
sequence F
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

48) chain A
residue 310
type
ligand
sequence N
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

49) chain A
residue 325
type
ligand
sequence F
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

50) chain A
residue 326
type
ligand
sequence V
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

51) chain A
residue 329
type
ligand
sequence N
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

52) chain A
residue 333
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE WHJ A 601
source : AC9

53) chain A
residue 205
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

54) chain A
residue 206
type
ligand
sequence A
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

55) chain A
residue 209
type
ligand
sequence I
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

56) chain B
residue 130
type
ligand
sequence E
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

57) chain B
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

58) chain B
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

59) chain B
residue 161
type
ligand
sequence I
description BINDING SITE FOR RESIDUE Y01 B 401
source : BC1

60) chain B
residue 78
type
ligand
sequence L
description BINDING SITE FOR RESIDUE Y01 B 402
source : BC2

61) chain B
residue 85
type
ligand
sequence C
description BINDING SITE FOR RESIDUE Y01 B 402
source : BC2

62) chain B
residue 155
type
ligand
sequence R
description BINDING SITE FOR RESIDUE Y01 B 402
source : BC2

63) chain B
residue 159
type
ligand
sequence K
description BINDING SITE FOR RESIDUE Y01 B 402
source : BC2

64) chain B
residue 166
type
ligand
sequence W
description BINDING SITE FOR RESIDUE Y01 B 402
source : BC2

65) chain A
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

66) chain A
residue 164
type
ligand
sequence T
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

67) chain B
residue 180
type
ligand
sequence H
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

68) chain B
residue 181
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

69) chain B
residue 183
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

70) chain B
residue 184
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

71) chain B
residue 185
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

72) chain B
residue 204
type
ligand
sequence N
description BINDING SITE FOR RESIDUE 2CV B 501
source : BC3

73) chain B
residue 238
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 2CV B 502
source : BC4

74) chain B
residue 286
type
ligand
sequence H
description BINDING SITE FOR RESIDUE 2CV B 502
source : BC4

75) chain B
residue 296
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 2CV B 502
source : BC4

76) chain A
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV B 503
source : BC5

77) chain B
residue 205
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 2CV B 503
source : BC5

78) chain B
residue 47
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 2CV B 504
source : BC6

79) chain A
residue 185
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 2CV B 505
source : BC7

80) chain B
residue 160
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 2CV B 505
source : BC7

81) chain B
residue 163
type
ligand
sequence C
description BINDING SITE FOR RESIDUE 2CV B 505
source : BC7

82) chain B
residue 166
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 2CV B 505
source : BC7

83) chain B
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

84) chain B
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

85) chain B
residue 125
type
ligand
sequence V
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

86) chain B
residue 199
type
ligand
sequence C
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

87) chain B
residue 200
type
ligand
sequence D
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

88) chain B
residue 208
type
ligand
sequence A
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

89) chain B
residue 211
type
ligand
sequence S
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

90) chain B
residue 215
type
ligand
sequence S
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

91) chain B
residue 306
type
ligand
sequence F
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

92) chain B
residue 310
type
ligand
sequence N
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

93) chain B
residue 329
type
ligand
sequence N
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

94) chain B
residue 333
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE WHJ B 601
source : BC8

95) chain A
residue 91
type BINDING
ligand
sequence G
description Agonist or antagonist.
source Swiss-Prot : SWS_FT_FI1

96) chain A
residue 96
type BINDING
ligand
sequence P
description Agonist or antagonist. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI2

97) chain A
residue 176-201
type TRANSMEM
ligand
sequence PIMMHWWRDEDPQALKCYQDPGCCDF
description Helical; Name=5.
source Swiss-Prot : SWS_FT_FI3

98) chain A
residue 47-73
type TRANSMEM
ligand
sequence LMALVVLLIVAGNVLVIAAIGSTQRLQ
description Helical; Name=2.
source Swiss-Prot : SWS_FT_FI7

99) chain A
residue 86-107
type TRANSMEM
ligand
sequence ADLVVGLLVVPFGATLVVRGTW
description Helical; Name=3.
source Swiss-Prot : SWS_FT_FI8

100) chain A
residue 126-149
type TRANSMEM
ligand
sequence TASIETLCVIAIDRYLAITSPFRY
description Helical; Name=4.
source Swiss-Prot : SWS_FT_FI9

101) chain B
residue 91
type BINDING
ligand
sequence G
description Agonist or antagonist.
source Swiss-Prot : SWS_FT_FI10

102) chain B
residue 96
type BINDING
ligand
sequence P
description Agonist or antagonist. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI11

103) chain B
residue 176-201
type TRANSMEM
ligand
sequence PIMMHWWRDEDPQALKCYQDPGCCDF
description Helical; Name=5.
source Swiss-Prot : SWS_FT_FI12

104) chain B
residue 47-73
type TRANSMEM
ligand
sequence LMALVVLLIVAGNVLVIAAIGSTQRLQ
description Helical; Name=2.
source Swiss-Prot : SWS_FT_FI16

105) chain B
residue 86-107
type TRANSMEM
ligand
sequence ADLVVGLLVVPFGATLVVRGTW
description Helical; Name=3.
source Swiss-Prot : SWS_FT_FI17

106) chain B
residue 126-149
type TRANSMEM
ligand
sequence TASIETLCVIAIDRYLAITSPFRY
description Helical; Name=4.
source Swiss-Prot : SWS_FT_FI18

107) chain A
residue 127-143
type prosite
ligand
sequence ASIETLCVIAIDRYLAI
description G-protein coupled receptors family 1 signature. [GSTALIVMFYWC]-[GSTANCPDE]-{EDPKRH}-x-{PQ}-[LIVMNQGA]-{RK}-{RK}-[LIVMFT]
source prosite : PS00237

108) chain B
residue 127-143
type prosite
ligand
sequence ASIETLCVIAIDRYLAI
description G-protein coupled receptors family 1 signature. [GSTALIVMFYWC]-[GSTANCPDE]-{EDPKRH}-x-{PQ}-[LIVMNQGA]-{RK}-{RK}-[LIVMFT]
source prosite : PS00237

109) chain A
residue 44
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

110) chain A
residue 47
type binding
ligand 2CV: HEGA-10
sequence L
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

111) chain A
residue 51
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

112) chain A
residue 102
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

113) chain A
residue 326-327
type binding
ligand 2CV: HEGA-10
sequence VA
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

114) chain A
residue 330-331
type binding
ligand 2CV: HEGA-10
sequence WL
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

115) chain A
residue 334
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

116) chain A
residue 338
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_504

117) chain A
residue 73
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence Q
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

118) chain A
residue 78
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

119) chain A
residue 81-82
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence TS
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

120) chain A
residue 85
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence C
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

121) chain A
residue 89
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence V
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

122) chain A
residue 93
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

123) chain A
residue 120
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

124) chain A
residue 123
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

125) chain A
residue 155
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence R
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

126) chain A
residue 159
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence K
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

127) chain A
residue 162-163
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IC
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

128) chain A
residue 166
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence W
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_402

129) chain A
residue 117-118
type binding
ligand WHJ: CARMOTEROL
sequence WT
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

130) chain A
residue 121-122
type binding
ligand WHJ: CARMOTEROL
sequence DV
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

131) chain A
residue 125
type binding
ligand WHJ: CARMOTEROL
sequence V
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

132) chain A
residue 200-201
type binding
ligand WHJ: CARMOTEROL
sequence DF
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

133) chain A
residue 203
type binding
ligand WHJ: CARMOTEROL
sequence T
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

134) chain A
residue 207-208
type binding
ligand WHJ: CARMOTEROL
sequence YA
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

135) chain A
residue 211-212
type binding
ligand WHJ: CARMOTEROL
sequence SS
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

136) chain A
residue 215
type binding
ligand WHJ: CARMOTEROL
sequence S
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

137) chain A
residue 303
type binding
ligand WHJ: CARMOTEROL
sequence W
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

138) chain A
residue 306-307
type binding
ligand WHJ: CARMOTEROL
sequence FF
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

139) chain A
residue 310
type binding
ligand WHJ: CARMOTEROL
sequence N
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

140) chain A
residue 325-326
type binding
ligand WHJ: CARMOTEROL
sequence FV
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

141) chain A
residue 329-330
type binding
ligand WHJ: CARMOTEROL
sequence NW
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

142) chain A
residue 333
type binding
ligand WHJ: CARMOTEROL
sequence Y
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_A_601

143) chain A
residue 123
type binding
ligand 2CV: HEGA-10
sequence L
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

144) chain A
residue 159-160
type binding
ligand 2CV: HEGA-10
sequence KV
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

145) chain A
residue 163
type binding
ligand 2CV: HEGA-10
sequence C
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

146) chain A
residue 166-167
type binding
ligand 2CV: HEGA-10
sequence WA
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

147) chain A
residue 170
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

148) chain A
residue 174
type binding
ligand 2CV: HEGA-10
sequence F
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

149) chain B
residue 181
type binding
ligand 2CV: HEGA-10
sequence W
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

150) chain B
residue 185
type binding
ligand 2CV: HEGA-10
sequence E
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_505

151) chain A
residue 130
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence E
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

152) chain A
residue 133-134
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence CV
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

153) chain A
residue 137
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

154) chain A
residue 157
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence R
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

155) chain A
residue 160-161
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence VI
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

156) chain A
residue 164-165
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence TV
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

157) chain A
residue 168
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

158) chain A
residue 172
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence V
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

159) chain A
residue 214
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

160) chain A
residue 218-219
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IP
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

161) chain A
residue 222
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

162) chain B
residue 205-206
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence RA
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

163) chain B
residue 209-210
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IA
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

164) chain B
residue 213-214
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence II
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

165) chain B
residue 218
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_A_401

166) chain A
residue 136
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

167) chain A
residue 139
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

168) chain A
residue 227
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

169) chain A
residue 230-231
type binding
ligand 2CV: HEGA-10
sequence VY
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

170) chain A
residue 289-290
type binding
ligand 2CV: HEGA-10
sequence LK
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

171) chain A
residue 292-293
type binding
ligand 2CV: HEGA-10
sequence LG
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

172) chain A
residue 296
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_502

173) chain A
residue 152-153
type binding
ligand 2CV: HEGA-10
sequence LM
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

174) chain A
residue 157
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

175) chain A
residue 161
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

176) chain B
residue 205
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

177) chain B
residue 209
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

178) chain B
residue 314-317
type binding
ligand 2CV: HEGA-10
sequence VFNR
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_503

179) chain A
residue 160
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

180) chain A
residue 164
type binding
ligand 2CV: HEGA-10
sequence T
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

181) chain A
residue 167-168
type binding
ligand 2CV: HEGA-10
sequence AI
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

182) chain A
residue 171-172
type binding
ligand 2CV: HEGA-10
sequence LV
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

183) chain B
residue 176
type binding
ligand 2CV: HEGA-10
sequence P
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

184) chain B
residue 180-185
type binding
ligand 2CV: HEGA-10
sequence HWWRDE
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

185) chain B
residue 204
type binding
ligand 2CV: HEGA-10
sequence N
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

186) chain B
residue 206-207
type binding
ligand 2CV: HEGA-10
sequence AY
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

187) chain B
residue 210-211
type binding
ligand 2CV: HEGA-10
sequence AS
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

188) chain B
residue 214
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_501

189) chain A
residue 172
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

190) chain A
residue 176
type binding
ligand 2CV: HEGA-10
sequence P
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

191) chain A
residue 180-181
type binding
ligand 2CV: HEGA-10
sequence HW
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

192) chain A
residue 183-185
type binding
ligand 2CV: HEGA-10
sequence RDE
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

193) chain A
residue 204
type binding
ligand 2CV: HEGA-10
sequence N
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

194) chain A
residue 206-207
type binding
ligand 2CV: HEGA-10
sequence AY
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

195) chain A
residue 210-211
type binding
ligand 2CV: HEGA-10
sequence AS
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

196) chain A
residue 214
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

197) chain B
residue 160
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

198) chain B
residue 164
type binding
ligand 2CV: HEGA-10
sequence T
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

199) chain B
residue 167-168
type binding
ligand 2CV: HEGA-10
sequence AI
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

200) chain B
residue 171
type binding
ligand 2CV: HEGA-10
sequence L
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_501

201) chain A
residue 181
type binding
ligand 2CV: HEGA-10
sequence W
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

202) chain A
residue 185
type binding
ligand 2CV: HEGA-10
sequence E
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

203) chain B
residue 123
type binding
ligand 2CV: HEGA-10
sequence L
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

204) chain B
residue 159-160
type binding
ligand 2CV: HEGA-10
sequence KV
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

205) chain B
residue 163
type binding
ligand 2CV: HEGA-10
sequence C
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

206) chain B
residue 166-167
type binding
ligand 2CV: HEGA-10
sequence WA
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

207) chain B
residue 170
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

208) chain B
residue 174
type binding
ligand 2CV: HEGA-10
sequence F
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_505

209) chain A
residue 205-206
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence RA
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

210) chain A
residue 209-210
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IA
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

211) chain A
residue 213-214
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence II
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

212) chain A
residue 218
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

213) chain B
residue 130
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence E
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

214) chain B
residue 133-134
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence CV
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

215) chain B
residue 137
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

216) chain B
residue 157
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence R
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

217) chain B
residue 160-161
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence VI
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

218) chain B
residue 164-165
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence TV
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

219) chain B
residue 168
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

220) chain B
residue 172
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence V
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

221) chain B
residue 214
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

222) chain B
residue 218-219
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IP
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

223) chain B
residue 222
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence I
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_401

224) chain A
residue 205
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

225) chain A
residue 209
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

226) chain A
residue 314-315
type binding
ligand 2CV: HEGA-10
sequence VF
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

227) chain A
residue 317
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

228) chain B
residue 137
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

229) chain B
residue 148
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

230) chain B
residue 152-153
type binding
ligand 2CV: HEGA-10
sequence LM
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

231) chain B
residue 157
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

232) chain B
residue 161
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_A_503

233) chain B
residue 44
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_504

234) chain B
residue 47-48
type binding
ligand 2CV: HEGA-10
sequence LM
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_504

235) chain B
residue 51
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_504

236) chain B
residue 102
type binding
ligand 2CV: HEGA-10
sequence V
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_504

237) chain B
residue 330
type binding
ligand 2CV: HEGA-10
sequence W
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_504

238) chain B
residue 78
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

239) chain B
residue 81-82
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence TS
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

240) chain B
residue 85
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence C
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

241) chain B
residue 89
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence V
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

242) chain B
residue 93
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

243) chain B
residue 120
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

244) chain B
residue 123
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence L
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

245) chain B
residue 155
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence R
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

246) chain B
residue 159
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence K
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

247) chain B
residue 162-163
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence IC
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

248) chain B
residue 166
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence W
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

249) chain B
residue 174
type binding
ligand Y01: CHOLESTEROL HEMISUCCINATE
sequence F
description CHOLESTEROL HEMISUCCINATE binding site
source pdb_hetatom : Y01_2y02_B_402

250) chain B
residue 101
type binding
ligand WHJ: CARMOTEROL
sequence L
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

251) chain B
residue 117-118
type binding
ligand WHJ: CARMOTEROL
sequence WT
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

252) chain B
residue 121-122
type binding
ligand WHJ: CARMOTEROL
sequence DV
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

253) chain B
residue 125
type binding
ligand WHJ: CARMOTEROL
sequence V
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

254) chain B
residue 199-201
type binding
ligand WHJ: CARMOTEROL
sequence CDF
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

255) chain B
residue 203
type binding
ligand WHJ: CARMOTEROL
sequence T
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

256) chain B
residue 207-208
type binding
ligand WHJ: CARMOTEROL
sequence YA
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

257) chain B
residue 211-212
type binding
ligand WHJ: CARMOTEROL
sequence SS
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

258) chain B
residue 215
type binding
ligand WHJ: CARMOTEROL
sequence S
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

259) chain B
residue 303
type binding
ligand WHJ: CARMOTEROL
sequence W
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

260) chain B
residue 306-307
type binding
ligand WHJ: CARMOTEROL
sequence FF
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

261) chain B
residue 310
type binding
ligand WHJ: CARMOTEROL
sequence N
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

262) chain B
residue 325-326
type binding
ligand WHJ: CARMOTEROL
sequence FV
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

263) chain B
residue 329
type binding
ligand WHJ: CARMOTEROL
sequence N
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

264) chain B
residue 333
type binding
ligand WHJ: CARMOTEROL
sequence Y
description CARMOTEROL binding site
source pdb_hetatom : WHJ_2y02_B_601

265) chain B
residue 136
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

266) chain B
residue 139
type binding
ligand 2CV: HEGA-10
sequence R
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

267) chain B
residue 227
type binding
ligand 2CV: HEGA-10
sequence A
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

268) chain B
residue 230-231
type binding
ligand 2CV: HEGA-10
sequence VY
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

269) chain B
residue 234-235
type binding
ligand 2CV: HEGA-10
sequence AK
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

270) chain B
residue 238
type binding
ligand 2CV: HEGA-10
sequence I
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

271) chain B
residue 283
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

272) chain B
residue 286
type binding
ligand 2CV: HEGA-10
sequence H
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

273) chain B
residue 289-290
type binding
ligand 2CV: HEGA-10
sequence LK
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

274) chain B
residue 292-293
type binding
ligand 2CV: HEGA-10
sequence LG
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502

275) chain B
residue 296
type binding
ligand 2CV: HEGA-10
sequence M
description HEGA-10 binding site
source pdb_hetatom : 2CV_2y02_B_502


Display surface

Download
Links