eF-site ID 2xyf-A PDB Code 2xyf Chain A click to enlarge Title HIV-1 Inhibitors with a Tertiary-Alcohol-containing Transition-State Mimic and various P2 and P1 prime Substituents Classification HYDROLASE Compound PROTEASE Source null (POL_HV1B1) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 3) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 4) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 5) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 6) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 7) chain A residue 47 type sequence I description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 8) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 9) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 10) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 11) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 12) chain A residue 82 type sequence T description BINDING SITE FOR RESIDUE G40 B 1200 source : AC1 13) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 14) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links