eF-site ID 2xye-AB PDB Code 2xye Chain A, B click to enlarge Title HIV-1 Inhibitors with a Tertiary-Alcohol-containing Transition-State Mimic and various P2 and P1 prime Substituents Classification HYDROLASE Compound PROTEASE Source null (POL_HV1B1) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF B:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 2) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 3) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 4) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 5) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 6) chain A residue 47 type sequence I description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 7) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 8) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 9) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 10) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 11) chain A residue 82 type sequence T description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 12) chain B residue 123 type sequence L description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 13) chain B residue 125 type sequence D description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 14) chain B residue 127 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 15) chain B residue 128 type sequence A description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 16) chain B residue 129 type sequence D description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 17) chain B residue 148 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 18) chain B residue 149 type sequence G description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 19) chain B residue 150 type sequence I description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 20) chain B residue 153 type sequence F description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 21) chain B residue 181 type sequence P description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 22) chain B residue 182 type sequence T description BINDING SITE FOR RESIDUE CXG B 1200 source : AC1 23) chain B residue 125 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 26) chain B residue 199 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141

Display surface Download Links