eF-site ID 2xrb-A PDB Code 2xrb Chain A click to enlarge Title Structure of the N-terminal four domains of the complement regulator Rat Crry Classification IMMUNE SYSTEM Compound COMPLEMENT REGULATORY PROTEIN CRRY Source Rattus norvegicus (Rat) (CRRY_RAT) Sequence A:  QCPAPPLFPYAKPINPTDESTFPVGTSLKYECRPGYIKRQ FSITCEVNSVWTSPQDVCIRKQCETPLDPQNGIVHVNTDI RFGSSITYTCNEGYRLIGSSSAMCIISDQSVAWDAEAPIC ESIPCEIPPSIPNGDFFSPNREDFHYGMVVTYQCNTDARG KKLFNLVGEPSIHCTSIDGQVGVWSGPPPQCIELNKCTPP HVENAVIVSKNKSLFSLRDMVEFRCQDGFMMKGDSSVYCR SLNRWEPQLPSCAA Description Functional site 1) chain A residue 101 type sequence T description BINDING SITE FOR RESIDUE SO4 A 1000 source : AC1 2) chain A residue 254 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1000 source : AC1 3) chain A residue 276 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1000 source : AC1 4) chain A residue 277 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1000 source : AC1 5) chain A residue 69 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 6) chain A residue 70 type sequence P description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 7) chain A residue 75 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 8) chain A residue 78 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 9) chain A residue 236 type sequence P description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 10) chain A residue 237 type sequence H description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 11) chain A residue 238 type sequence V description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 12) chain A residue 241 type sequence A description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 13) chain A residue 243 type sequence I description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 14) chain A residue 259 type sequence F description BINDING SITE FOR RESIDUE SO4 A 1002 source : AC3 15) chain A residue 198 type sequence K description BINDING SITE FOR RESIDUE EDO A 3001 source : AC4 16) chain A residue 200 type sequence F description BINDING SITE FOR RESIDUE EDO A 3001 source : AC4 17) chain A residue 201 type sequence N description BINDING SITE FOR RESIDUE EDO A 3001 source : AC4 18) chain A residue 202 type sequence L description BINDING SITE FOR RESIDUE EDO A 3001 source : AC4 19) chain A residue 105 type sequence P description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 20) chain A residue 106 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 21) chain A residue 154 type sequence P description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 22) chain A residue 155 type sequence I description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 23) chain A residue 156 type sequence C description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 24) chain A residue 274 type sequence Y description BINDING SITE FOR RESIDUE EDO A 3002 source : AC5 25) chain A residue 73 type sequence I description BINDING SITE FOR RESIDUE EDO A 3003 source : AC6 26) chain A residue 75 type sequence R description BINDING SITE FOR RESIDUE EDO A 3003 source : AC6 27) chain A residue 93 type sequence V description BINDING SITE FOR RESIDUE EDO A 3003 source : AC6 28) chain A residue 94 type sequence C description BINDING SITE FOR RESIDUE EDO A 3003 source : AC6 29) chain A residue 95 type sequence I description BINDING SITE FOR RESIDUE EDO A 3003 source : AC6 30) chain A residue 234 type sequence T description BINDING SITE FOR RESIDUE EDO A 3004 source : AC7 31) chain A residue 279 type sequence N description BINDING SITE FOR RESIDUE EDO A 3004 source : AC7 32) chain A residue 281 type sequence W description BINDING SITE FOR RESIDUE EDO A 3004 source : AC7 33) chain A residue 124 type sequence Y description BINDING SITE FOR RESIDUE EDO A 3005 source : AC8 34) chain A residue 149 type sequence W description BINDING SITE FOR RESIDUE EDO A 3005 source : AC8 35) chain A residue 151 type sequence A description BINDING SITE FOR RESIDUE EDO A 3005 source : AC8 36) chain A residue 152 type sequence E description BINDING SITE FOR RESIDUE EDO A 3005 source : AC8 37) chain A residue 153 type sequence A description BINDING SITE FOR RESIDUE EDO A 3005 source : AC8 38) chain A residue 72 type sequence Y description BINDING SITE FOR RESIDUE EDO A 3006 source : AC9 39) chain A residue 91 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3006 source : AC9 40) chain A residue 96 type sequence R description BINDING SITE FOR RESIDUE EDO A 3006 source : AC9 41) chain A residue 119 type sequence G description BINDING SITE FOR RESIDUE EDO A 3006 source : AC9 42) chain A residue 238 type sequence V description BINDING SITE FOR RESIDUE EDO A 3007 source : BC1 43) chain A residue 239 type sequence E description BINDING SITE FOR RESIDUE EDO A 3007 source : BC1 44) chain A residue 246 type sequence K description BINDING SITE FOR RESIDUE EDO A 3007 source : BC1 45) chain A residue 247 type sequence N description BINDING SITE FOR RESIDUE EDO A 3007 source : BC1 46) chain A residue 102 type sequence P description BINDING SITE FOR RESIDUE EDO A 3008 source : BC2 47) chain A residue 112 type sequence V description BINDING SITE FOR RESIDUE EDO A 3008 source : BC2 48) chain A residue 133 type sequence I description BINDING SITE FOR RESIDUE EDO A 3008 source : BC2 49) chain A residue 134 type sequence G description BINDING SITE FOR RESIDUE EDO A 3008 source : BC2 50) chain A residue 139 type sequence M description BINDING SITE FOR RESIDUE EDO A 3009 source : BC3 51) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE EDO A 3009 source : BC3 52) chain A residue 98 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3010 source : BC4 53) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE EDO A 3010 source : BC4 54) chain A residue 109 type sequence I description BINDING SITE FOR RESIDUE EDO A 3011 source : BC5 55) chain A residue 110 type sequence V description BINDING SITE FOR RESIDUE EDO A 3011 source : BC5 56) chain A residue 111 type sequence H description BINDING SITE FOR RESIDUE EDO A 3011 source : BC5 57) chain A residue 112 type sequence V description BINDING SITE FOR RESIDUE EDO A 3011 source : BC5 58) chain A residue 216 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3011 source : BC5 59) chain A residue 104 type sequence D description BINDING SITE FOR RESIDUE EDO A 3012 source : BC6 60) chain A residue 282 type sequence E description BINDING SITE FOR RESIDUE EDO A 3012 source : BC6 61) chain A residue 284 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3012 source : BC6 62) chain A residue 276 type sequence R description BINDING SITE FOR RESIDUE EDO A 3014 source : BC7 63) chain A residue 280 type sequence R description BINDING SITE FOR RESIDUE EDO A 3014 source : BC7 64) chain A residue 281 type sequence W description BINDING SITE FOR RESIDUE EDO A 3014 source : BC7 65) chain A residue 284 type sequence Q description BINDING SITE FOR RESIDUE EDO A 3014 source : BC7 66) chain A residue 53 type CARBOHYD sequence T description O-linked (GalNAc...) threonine => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links