eF-site ID 2xmh-A PDB Code 2xmh Chain A click to enlarge Title The X-ray structure of CTP:inositol-1-phosphate cytidylyltransferase from Archaeoglobus fulgidus Classification TRANSFERASE Compound CTP-INOSITOL-1-PHOSPHATE CYTIDYLYLTRANSFERASE Source (O29976_ARCFU) Sequence A:  IKLMKAVILAVPKPLVRVGGCEIILRTMKLLSPHVSEFII VASRYADDIDAFLKDKGFNYKIVRHDRPEKGNGYSLLVAK NHVEDRFILTMGDHVYSQQFIEKAVRGEGVIADREPRFVD IGEATKIRVEDGRVAKIGKDLREFDCVDTGFFVLDDSIFE HAEKLRDREEIPLSEIVKLARLPVTYVDGELWMDVD Description (1)  CTP-INOSITOL-1-PHOSPHATE CYTIDYLYLTRANSFERASE Functional site 1) chain A residue 25 type sequence A description BINDING SITE FOR RESIDUE FLC A 501 source : AC1 2) chain A residue 37 type sequence K description BINDING SITE FOR RESIDUE FLC A 501 source : AC1 3) chain A residue 38 type sequence P description BINDING SITE FOR RESIDUE FLC A 501 source : AC1 4) chain A residue 68 type sequence R description BINDING SITE FOR RESIDUE FLC A 501 source : AC1 5) chain A residue 24 type BINDING sequence L description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 37 type BINDING sequence K description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 90 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 126 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links