eF-site ID 2xgx-B
PDB Code 2xgx
Chain B

click to enlarge
Title Crystal structure of transcription factor NtcA from Synechococcus elongatus (mercury derivative)
Classification TRANSCRIPTION
Compound GLOBAL NITROGEN REGULATOR
Source Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) (NTCA_SYNE7)
Sequence B:  NSLLTMFRELGPLQIEQFERGKTIFFPGDPAERVYLLVKG
AVKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFY
HAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSRI
LQTEMMIETLAHRDMGSRLVSFLLILCRDFGIPSPDGITI
DLKLSHQAIAEAIGSTRVTVTRLLGDLRESKLIAIHKKRI
TVFNPVALSQQFS
Description (1)  GLOBAL NITROGEN REGULATOR


Functional site

1) chain B
residue 129
type
ligand
sequence I
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

2) chain B
residue 133
type
ligand
sequence E
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

3) chain B
residue 53
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

4) chain B
residue 74
type
ligand
sequence F
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

5) chain B
residue 75
type
ligand
sequence G
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

6) chain B
residue 76
type
ligand
sequence V
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

7) chain B
residue 77
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

8) chain B
residue 87
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

9) chain B
residue 128
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

10) chain B
residue 156
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HG B 801
source : AC4

11) chain B
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HG B 801
source : AC4

12) chain B
residue 175-194
type DNA_BIND
ligand
sequence HQAIAEAIGSTRVTVTRLLG
description H-T-H motif (By similarity).
source Swiss-Prot : SWS_FT_FI3

13) chain B
residue 6-128
type NP_BIND
ligand
sequence NSLLTMFRELGPLQIEQFERGKTIFFPGDPAERVYLLVKG
AVKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFY
HAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSR
description cNMP.
source Swiss-Prot : SWS_FT_FI4

14) chain B
residue 173-196
type prosite
ligand
sequence LSHQAIAEAIGSTRVTVTRLLGDL
description Crp-type HTH domain signature. [LIVM]-[STAG]-[RHNWM]-x(2)-[LIM]-[GA]-x-[LIVMFYAS]-[LIVSC]-[GA]-x
source prosite : PS00042

15) chain B
residue 133
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence E
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

16) chain B
residue 34
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence F
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

17) chain B
residue 40
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

18) chain B
residue 53
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence L
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

19) chain B
residue 73-78
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence VFGVLS
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

20) chain B
residue 87-89
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence RFY
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

21) chain B
residue 128
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence R
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519


Display surface

Download
Links