eF-site ID 2xgx-AB
PDB Code 2xgx
Chain A, B

click to enlarge
Title Crystal structure of transcription factor NtcA from Synechococcus elongatus (mercury derivative)
Classification TRANSCRIPTION
Compound GLOBAL NITROGEN REGULATOR
Source Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) (NTCA_SYNE7)
Sequence A:  NSLLTMFRELPLQIEQFERGKTIFFPGDPAERVYLLVKGA
VKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFYH
AVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSRIL
QTEMMIETLAHRDMGSRLVSFLLILCRDFGIPSPDGITID
LKLSHQAIAEAIGSTRVTVTRLLGDLRESKLIAIHKKRIT
VFNPVALSQQFS
B:  NSLLTMFRELGPLQIEQFERGKTIFFPGDPAERVYLLVKG
AVKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFY
HAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSRI
LQTEMMIETLAHRDMGSRLVSFLLILCRDFGIPSPDGITI
DLKLSHQAIAEAIGSTRVTVTRLLGDLRESKLIAIHKKRI
TVFNPVALSQQFS
Description (1)  GLOBAL NITROGEN REGULATOR


Functional site

1) chain A
residue 53
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

2) chain A
residue 74
type
ligand
sequence F
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

3) chain A
residue 75
type
ligand
sequence G
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

4) chain A
residue 76
type
ligand
sequence V
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

5) chain A
residue 77
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

6) chain A
residue 87
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

7) chain A
residue 128
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

8) chain B
residue 129
type
ligand
sequence I
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

9) chain B
residue 133
type
ligand
sequence E
description BINDING SITE FOR RESIDUE AKG A 519
source : AC1

10) chain A
residue 156
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HG A 801
source : AC2

11) chain A
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HG A 801
source : AC2

12) chain A
residue 129
type
ligand
sequence I
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

13) chain A
residue 133
type
ligand
sequence E
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

14) chain B
residue 53
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

15) chain B
residue 74
type
ligand
sequence F
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

16) chain B
residue 75
type
ligand
sequence G
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

17) chain B
residue 76
type
ligand
sequence V
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

18) chain B
residue 77
type
ligand
sequence L
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

19) chain B
residue 87
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

20) chain B
residue 128
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AKG B 519
source : AC3

21) chain B
residue 156
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HG B 801
source : AC4

22) chain B
residue 157
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HG B 801
source : AC4

23) chain A
residue 33
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BTB A 1223
source : AC5

24) chain A
residue 38
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BTB A 1223
source : AC5

25) chain A
residue 191
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BTB A 1223
source : AC5

26) chain A
residue 194
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BTB A 1223
source : AC5

27) chain A
residue 195
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BTB A 1223
source : AC5

28) chain A
residue 175-194
type DNA_BIND
ligand
sequence HQAIAEAIGSTRVTVTRLLG
description H-T-H motif (By similarity).
source Swiss-Prot : SWS_FT_FI1

29) chain A
residue 6-128
type NP_BIND
ligand
sequence NSLLTMFRELPLQIEQFERGKTIFFPGDPAERVYLLVKGA
VKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFYH
AVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSR
description cNMP.
source Swiss-Prot : SWS_FT_FI2

30) chain B
residue 175-194
type DNA_BIND
ligand
sequence HQAIAEAIGSTRVTVTRLLG
description H-T-H motif (By similarity).
source Swiss-Prot : SWS_FT_FI3

31) chain B
residue 6-128
type NP_BIND
ligand
sequence NSLLTMFRELGPLQIEQFERGKTIFFPGDPAERVYLLVKG
AVKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFY
HAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSR
description cNMP.
source Swiss-Prot : SWS_FT_FI4

32) chain A
residue 173-196
type prosite
ligand
sequence LSHQAIAEAIGSTRVTVTRLLGDL
description Crp-type HTH domain signature. [LIVM]-[STAG]-[RHNWM]-x(2)-[LIM]-[GA]-x-[LIVMFYAS]-[LIVSC]-[GA]-x
source prosite : PS00042

33) chain B
residue 173-196
type prosite
ligand
sequence LSHQAIAEAIGSTRVTVTRLLGDL
description Crp-type HTH domain signature. [LIVM]-[STAG]-[RHNWM]-x(2)-[LIM]-[GA]-x-[LIVMFYAS]-[LIVSC]-[GA]-x
source prosite : PS00042

34) chain A
residue 34
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence F
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

35) chain A
residue 40
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

36) chain A
residue 53
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence L
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

37) chain A
residue 73-78
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence VFGVLS
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

38) chain A
residue 87-89
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence RFY
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

39) chain A
residue 128-130
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence RIL
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

40) chain B
residue 133
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence E
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_A_519

41) chain A
residue 129-130
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence IL
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

42) chain A
residue 133
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence E
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

43) chain B
residue 34
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence F
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

44) chain B
residue 40
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

45) chain B
residue 53
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence L
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

46) chain B
residue 73-78
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence VFGVLS
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

47) chain B
residue 87-89
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence RFY
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

48) chain B
residue 128
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence R
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_2xgx_B_519

49) chain A
residue 190-192
type binding
ligand BTB: 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence TRL
description 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : BTB_2xgx_A_1223

50) chain A
residue 194-195
type binding
ligand BTB: 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence GD
description 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : BTB_2xgx_A_1223

51) chain A
residue 198
type binding
ligand BTB: 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence E
description 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : BTB_2xgx_A_1223


Display surface

Download
Links