eF-site ID 2xez-A PDB Code 2xez Chain A click to enlarge Title Crystal structure of checkpoint kinase 1 (Chk1) in complex with inhibitors Classification TRANSFERASE Compound SERINE/THREONINE-PROTEIN KINASE CHK1 Source Homo sapiens (Human) (CHK1_HUMAN) Sequence A:  EDWDLVQTLGEVQLAVNRVTEEAVAVKIVDMNIKKEICIN KMLNHENVVKFYGHRREIQYLFLEYCSGGELFDRIEPDIG MPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDER DNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKR REFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDW KEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKK DRWYNKPLK Description Functional site 1) chain A residue 36 type sequence A description BINDING SITE FOR RESIDUE XEZ A 1271 source : AC1 2) chain A residue 38 type sequence K description BINDING SITE FOR RESIDUE XEZ A 1271 source : AC1 3) chain A residue 85 type sequence E description BINDING SITE FOR RESIDUE XEZ A 1271 source : AC1 4) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE XEZ A 1271 source : AC1 5) chain A residue 137 type sequence L description BINDING SITE FOR RESIDUE XEZ A 1271 source : AC1 6) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE EDO A 1272 source : AC2 7) chain A residue 173 type sequence Y description BINDING SITE FOR RESIDUE EDO A 1272 source : AC2 8) chain A residue 204 type sequence G description BINDING SITE FOR RESIDUE EDO A 1272 source : AC2 9) chain A residue 206 type sequence L description BINDING SITE FOR RESIDUE EDO A 1272 source : AC2 10) chain A residue 54 type sequence K description BINDING SITE FOR RESIDUE EDO A 1273 source : AC3 11) chain A residue 129 type sequence R description BINDING SITE FOR RESIDUE EDO A 1273 source : AC3 12) chain A residue 153 type sequence T description BINDING SITE FOR RESIDUE EDO A 1273 source : AC3 13) chain A residue 166 type sequence K description BINDING SITE FOR RESIDUE EDO A 1273 source : AC3 14) chain A residue 91 type sequence E description BINDING SITE FOR RESIDUE EDO A 1274 source : AC4 15) chain A residue 94 type sequence D description BINDING SITE FOR RESIDUE EDO A 1274 source : AC4 16) chain A residue 57 type sequence C description BINDING SITE FOR RESIDUE EDO A 1275 source : AC5 17) chain A residue 97 type sequence E description BINDING SITE FOR RESIDUE EDO A 1275 source : AC5 18) chain A residue 154 type sequence V description BINDING SITE FOR RESIDUE EDO A 1275 source : AC5 19) chain A residue 123 type sequence G description BINDING SITE FOR RESIDUE EDO A 1276 source : AC6 20) chain A residue 156 type sequence R description BINDING SITE FOR RESIDUE EDO A 1276 source : AC6 21) chain A residue 157 type sequence Y description BINDING SITE FOR RESIDUE EDO A 1276 source : AC6 22) chain A residue 158 type sequence N description BINDING SITE FOR RESIDUE EDO A 1276 source : AC6 23) chain A residue 159 type sequence N description BINDING SITE FOR RESIDUE EDO A 1276 source : AC6 24) chain A residue 103 type sequence P description BINDING SITE FOR RESIDUE EDO A 1277 source : AC7 25) chain A residue 157 type sequence Y description BINDING SITE FOR RESIDUE EDO A 1277 source : AC7 26) chain A residue 158 type sequence N description BINDING SITE FOR RESIDUE EDO A 1277 source : AC7 27) chain A residue 132 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:32357935 source Swiss-Prot : SWS_FT_FI5 28) chain A residue 15-38 type prosite sequence LGEVQLAVNRVTEEAVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGAYGEVQlAvnrvteea..........VAVK source prosite : PS00107 29) chain A residue 126-138 type prosite sequence ITHRDIKPENLLL description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ItHrDIKpeNLLL source prosite : PS00108 30) chain A residue 130 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 31) chain A residue 15 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 38 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links