eF-site ID 2xdg-AB PDB Code 2xdg Chain A, B click to enlarge Title Crystal structure of the extracellular domain of human growth hormone releasing hormone receptor. Classification SIGNALING PROTEIN Compound GROWTH HORMONE-RELEASING HORMONE RECEPTOR Source Homo sapiens (Human) (GHRHR_HUMAN) Sequence A:  MLREDESACLQAAEEMPQTTLGCPATWDGLLCWPTAGSGE WVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVAC PVPLELLAE B:  MLREDESACLQAAEEMPQTTLGCPATWDGLLCWPTAGSGE WVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVAC PVPLELLAE Description Functional site 1) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE MG B 1122 source : AC1 2) chain B residue 84 type sequence H description BINDING SITE FOR RESIDUE MG B 1122 source : AC1 3) chain A residue 0 type sequence M description BINDING SITE FOR RESIDUE MG A 1122 source : AC2 4) chain A residue 80 type sequence D description BINDING SITE FOR RESIDUE MG A 1122 source : AC2 5) chain B residue 84 type sequence H description BINDING SITE FOR RESIDUE MG A 1122 source : AC2 6) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE MG B 1123 source : AC3 7) chain B residue 0 type sequence M description BINDING SITE FOR RESIDUE MG B 1123 source : AC3 8) chain B residue 80 type sequence D description BINDING SITE FOR RESIDUE MG B 1123 source : AC3 9) chain B residue 50 type sequence Q description BINDING SITE FOR RESIDUE EDO B 1124 source : AC4 10) chain B residue 72 type sequence E description BINDING SITE FOR RESIDUE EDO B 1124 source : AC4 11) chain B residue 73 type sequence W description BINDING SITE FOR RESIDUE EDO B 1124 source : AC4 12) chain A residue 72 type sequence E description BINDING SITE FOR RESIDUE EDO A 1123 source : AC5 13) chain A residue 73 type sequence W description BINDING SITE FOR RESIDUE EDO A 1123 source : AC5 14) chain A residue 50 type CARBOHYD sequence Q description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 15) chain B residue 50 type CARBOHYD sequence Q description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 55-79 type prosite sequence CPATWDGLLCWPTAGSGEWVTLPCP description G_PROTEIN_RECEP_F2_1 G-protein coupled receptors family 2 signature 1. CpatWDgll.CWptAgsgewvtlpCP source prosite : PS00649

Display surface Download Links