eF-site ID 2xbu-A PDB Code 2xbu Chain A click to enlarge Title Saccharomyces cerevisiae hypoxanthine-guanine phosphoribosyltransferase in complex with GMP (monoclinic crystal form) Classification TRANSFERASE Compound HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE Source (HPRT_YEAST) Sequence A:  DKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPA RILRTFLKEPGVPTIRIFAIILSLYEVKVSRTQWIDYEQC KLDLVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAK GIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNR YFAAKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFIPEQ E Description Functional site 1) chain A residue 60 type sequence R description BINDING SITE FOR RESIDUE ACT A 1219 source : AC1 2) chain A residue 114 type sequence D description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 3) chain A residue 115 type sequence T description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 4) chain A residue 116 type sequence R description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 5) chain A residue 117 type sequence T description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 6) chain A residue 118 type sequence T description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 7) chain A residue 159 type sequence K description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 8) chain A residue 188 type sequence W description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 9) chain A residue 189 type sequence Y description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 10) chain A residue 191 type sequence Y description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 11) chain A residue 194 type sequence E description BINDING SITE FOR RESIDUE 5GP A 1220 source : AC2 12) chain A residue 114 type ACT_SITE sequence D description Proton acceptor => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 85 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18245832 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 110 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18245832 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 159 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18245832 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 188 type BINDING sequence W description BINDING => ECO:0000269|PubMed:18245832 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links