eF-site ID 2x9c-AB
PDB Code 2x9c
Chain A, B

click to enlarge
Title Crystal structure of a soluble PrgI mutant from Salmonella Typhimurium
Classification PROTEIN TRANSPORT
Compound PROTEIN PRGI
Source (PRGI_SALTY)
Sequence A:  GVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYR
NAQSNTAKAFKDIDAAIIQNFR
B:  TGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLY
RNAQSNTAKAFKDIDAAIIQNFR
Description (1)  PROTEIN PRGI

Display surface

Download
Links