eF-site ID 2x7l-G
PDB Code 2x7l
Chain G

click to enlarge
Title Implications of the HIV-1 Rev dimer structure at 3.2A resolution for multimeric binding to the Rev response element
Classification IMMUNE SYSTEM
Compound FAB HEAVY CHAIN
Source (REV_HV1B1)
Sequence G:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
Description (1)  FAB HEAVY CHAIN, FAB LIGHT CHAIN, PROTEIN REV

Display surface

Download
Links