eF-site ID 2x7l-ABCDEFGHIJKLMNOPQR
PDB Code 2x7l
Chain A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
Title Implications of the HIV-1 Rev dimer structure at 3.2A resolution for multimeric binding to the Rev response element
Classification IMMUNE SYSTEM
Compound FAB HEAVY CHAIN
Source (REV_HV1B1)
Sequence A:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
B:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
C:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
D:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
E:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
F:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
G:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
H:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
I:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
J:  QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQA
PGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLK
LTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSAST
KGPSVFPLAPSAKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEPKSCD
K:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
L:  ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKP
GQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQR
EDAATYYCLGGYPAASYRTAFGGGTELEIIRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG
NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
M:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
N:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
O:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
P:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
Q:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
R:  DEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRER
QRQIHSISERILSTYLG
Description (1)  FAB HEAVY CHAIN, FAB LIGHT CHAIN, PROTEIN REV

Display surface

Download
Links