eF-site ID 2x1u-AB PDB Code 2x1u Chain A, B click to enlarge Title Crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase Classification ISOMERASE Compound TRIOSEPHOSPHATE ISOMERASE, GLYCOSOMAL Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence A:  SKPQPIAAANWSLSELIDLFNSTSINHDVQCVVASTFVHL AMTKERLSHPKFVIAAQNAGNADALASLKDFGVNWIVLGH SERRWYYGETNEIVADKVAAAVASGFMVIACIGETLQERE SGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTG KVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVN GKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ B:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ Description Functional site 1) chain A residue 32 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 2) chain A residue 33 type sequence I description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 3) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 4) chain A residue 35 type sequence H description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 5) chain A residue 247 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 6) chain A residue 250 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 7) chain A residue 22 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1252 source : AC2 8) chain A residue 50 type sequence M description BINDING SITE FOR RESIDUE SO4 A 1252 source : AC2 9) chain A residue 54 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1252 source : AC2 10) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1253 source : AC3 11) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1253 source : AC3 12) chain A residue 234 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1253 source : AC3 13) chain B residue 171 type sequence A description BINDING SITE FOR RESIDUE SO4 B 1251 source : AC4 14) chain B residue 173 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1251 source : AC4 15) chain B residue 213 type sequence S description BINDING SITE FOR RESIDUE SO4 B 1251 source : AC4 16) chain B residue 233 type sequence A description BINDING SITE FOR RESIDUE SO4 B 1251 source : AC4 17) chain B residue 234 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1251 source : AC4 18) chain B residue 32 type sequence S description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 19) chain B residue 33 type sequence I description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 20) chain B residue 34 type sequence N description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 21) chain B residue 35 type sequence H description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 22) chain B residue 247 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 23) chain B residue 250 type sequence Q description BINDING SITE FOR RESIDUE SO4 B 1252 source : AC5 24) chain B residue 155 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1253 source : AC6 25) chain B residue 156 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1253 source : AC6 26) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 27) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 28) chain B residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 29) chain B residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 30) chain A residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 31) chain B residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 32) chain A residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2 33) chain B residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2

Display surface Download Links