eF-site ID 2x1r-A PDB Code 2x1r Chain A click to enlarge Title Crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase Classification ISOMERASE Compound TRIOSEPHOSPHATE ISOMERASE, GLYCOSOMAL Source (TPIS_TRYBB) Sequence A:  SKPQPIAAANWSLSELIDLFNSTSINHDVQCVVASTFVHL AMTKERLSHPKFVIAAQNAGNADALASLKDFGVNWIVLGH SERRWYYGETNEIVADKVAAAVASGFMVIACIGETLQERE SGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTG KVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVN GKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ Description Functional site 1) chain A residue 32 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 2) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 3) chain A residue 35 type sequence H description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 4) chain A residue 247 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 5) chain A residue 250 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 1251 source : AC1 6) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 7) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 8) chain A residue 167 type sequence E description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 9) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 10) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 11) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 12) chain A residue 212 type sequence G description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 13) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE X1R A 1252 source : AC2 14) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 15) chain A residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 16) chain A residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 17) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links