eF-site ID 2wog-A PDB Code 2wog Chain A click to enlarge Title Intermediate and final states of human kinesin Eg5 in complex with S-trityl-L-cysteine Classification CELL CYCLE Compound KINESIN-LIKE PROTEIN KIF11 Source (KIF11_HUMAN) Sequence A:  KNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGG LADKSSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMG YNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGII PRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSS DVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEK GAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEELV KIGKLNLVDLAGSENNINQSLLTLGRVITALVERTPHVPY RESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLE YAHRAKNILNKPE Description Functional site 1) chain A residue 24 type sequence R description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 2) chain A residue 26 type sequence R description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 3) chain A residue 27 type sequence P description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 4) chain A residue 106 type sequence Q description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 5) chain A residue 107 type sequence T description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 6) chain A residue 108 type sequence G description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 7) chain A residue 109 type sequence T description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 8) chain A residue 110 type sequence G description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 9) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 10) chain A residue 112 type sequence T description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 11) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 12) chain A residue 118 type sequence E description BINDING SITE FOR RESIDUE ADP A 600 source : AC1 13) chain A residue 112 type sequence T description BINDING SITE FOR RESIDUE MG A 601 source : AC2 14) chain A residue 112 type sequence T description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 15) chain A residue 116 type sequence E description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 16) chain A residue 117 type sequence G description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 17) chain A residue 118 type sequence E description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 18) chain A residue 119 type sequence R description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 19) chain A residue 133 type sequence A description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 20) chain A residue 137 type sequence P description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 21) chain A residue 211 type sequence Y description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 22) chain A residue 214 type sequence L description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 23) chain A residue 215 type sequence E description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 24) chain A residue 221 type sequence R description BINDING SITE FOR RESIDUE ZZD A 1365 source : AC7 25) chain A residue 105 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00283 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 146 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 259-270 type prosite sequence GKLNLVDLAGSE description KINESIN_MOTOR_1 Kinesin motor domain signature. GKLnLVDLAGSE source prosite : PS00411

Display surface Download Links