eF-site ID 2wns-A PDB Code 2wns Chain A click to enlarge Title Human Orotate phosphoribosyltransferase (OPRTase) domain of Uridine 5' -monophosphate synthase (UMPS) in complex with its substrate orotidine 5'-monophosphate (OMP) Classification TRANSFERASE Compound OROTATE PHOSPHORIBOSYLTRANSFERASE Source (PYR5_HUMAN) Sequence A:  ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSR PRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVIC STNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVV TSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAH GIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQE Description Functional site 1) chain A residue 28 type sequence L description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 2) chain A residue 29 type sequence K description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 3) chain A residue 37 type sequence Y description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 4) chain A residue 38 type sequence I description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 5) chain A residue 123 type sequence E description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 6) chain A residue 124 type sequence D description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 7) chain A residue 125 type sequence V description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 8) chain A residue 127 type sequence T description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 9) chain A residue 128 type sequence S description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 10) chain A residue 129 type sequence G description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 11) chain A residue 130 type sequence S description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 12) chain A residue 131 type sequence S description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 13) chain A residue 155 type sequence R description BINDING SITE FOR RESIDUE OMP A 450 source : AC1 14) chain A residue 80 type sequence P description BINDING SITE FOR RESIDUE CL B 1208 source : AC3 15) chain A residue 83 type sequence T description BINDING SITE FOR RESIDUE CL B 1208 source : AC3 16) chain A residue 37 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 119-131 type prosite sequence CLIIEDVVTSGSS description PUR_PYR_PR_TRANSFER Purine/pyrimidine phosphoribosyl transferases signature. CLIIEDVVTSGsS source prosite : PS00103

Display surface Download Links