eF-site ID 2wmv-A PDB Code 2wmv Chain A click to enlarge Title Crystal structure of checkpoint kinase 1 (Chk1) in complex with inhibitors Classification TRANSFERASE Compound SERINE/THREONINE-PROTEIN KINASE CHK1 Source null (CHK1_HUMAN) Sequence A:  EDWDLVQTLGEVQLAVNRVTEEAVAVKIVDMNIKKEICIN KMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPD IGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLD ERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELL KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYS DWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDI KKDRWYNKPLK Description Functional site 1) chain A residue 15 type sequence L description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 2) chain A residue 36 type sequence A description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 3) chain A residue 85 type sequence E description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 4) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 5) chain A residue 91 type sequence E description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 6) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 7) chain A residue 137 type sequence L description BINDING SITE FOR RESIDUE ZYV A 1271 source : AC1 8) chain A residue 130 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 9) chain A residue 132 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:32357935 source Swiss-Prot : SWS_FT_FI5 10) chain A residue 15-38 type prosite sequence LGEVQLAVNRVTEEAVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGAYGEVQlAvnrvteea..........VAVK source prosite : PS00107 11) chain A residue 126-138 type prosite sequence ITHRDIKPENLLL description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ItHrDIKpeNLLL source prosite : PS00108 12) chain A residue 38 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 15 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links