eF-site ID 2wlg-A PDB Code 2wlg Chain A click to enlarge Title Crystallographic analysis of the polysialic acid O-acetyltransferase OatWY Classification TRANSFERASE Compound POLYSIALIC ACID O-ACETYLTRANSFERASE Source Neisseria meningitidis (Q93S40_NEIME) Sequence A:  MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCK IVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQA KTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIY SLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVV GSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTM YDDPTLNEFYK Description Functional site 1) chain A residue 116 type sequence R description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 2) chain A residue 119 type sequence D description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 3) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 4) chain A residue 123 type sequence I description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 5) chain A residue 133 type sequence N description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 6) chain A residue 154 type sequence K description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 7) chain A residue 171 type sequence Y description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 8) chain A residue 184 type sequence S description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 9) chain A residue 185 type sequence P description BINDING SITE FOR RESIDUE SOP A 1216 source : AC2 10) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 11) chain A residue 35 type sequence N description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 12) chain A residue 36 type sequence S description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 13) chain A residue 56 type sequence N description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 14) chain A residue 57 type sequence I description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 15) chain A residue 58 type sequence T description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 16) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 17) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE EDO A 1217 source : AC6 18) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE EDO A 1218 source : AC7 19) chain A residue 14 type sequence T description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 20) chain A residue 16 type sequence N description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 21) chain A residue 36 type sequence S description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 22) chain A residue 37 type sequence V description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 23) chain A residue 60 type sequence F description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 24) chain A residue 83 type sequence Q description BINDING SITE FOR RESIDUE EDO A 1219 source : AC8 25) chain A residue 184 type sequence S description BINDING SITE FOR RESIDUE EDO A 1220 source : BC1 26) chain A residue 199 type sequence M description BINDING SITE FOR RESIDUE EDO B 1216 source : BC2 27) chain A residue 147 type sequence G description BINDING SITE FOR RESIDUE EDO A 1221 source : BC5 28) chain A residue 166 type sequence S description BINDING SITE FOR RESIDUE EDO A 1221 source : BC5 29) chain A residue 6 type sequence Y description BINDING SITE FOR RESIDUE EDO A 1222 source : BC6 30) chain A residue 13 type sequence N description BINDING SITE FOR RESIDUE EDO A 1222 source : BC6 31) chain A residue 14 type sequence T description BINDING SITE FOR RESIDUE EDO A 1222 source : BC6 32) chain A residue 15 type sequence I description BINDING SITE FOR RESIDUE EDO A 1222 source : BC6 33) chain A residue 105 type sequence K description BINDING SITE FOR RESIDUE EDO A 1222 source : BC6 34) chain A residue 75 type sequence H description BINDING SITE FOR RESIDUE EDO A 1223 source : BC7 35) chain A residue 96 type sequence A description BINDING SITE FOR RESIDUE EDO A 1223 source : BC7 36) chain A residue 97 type sequence E description BINDING SITE FOR RESIDUE EDO A 1223 source : BC7 37) chain A residue 136 type sequence K description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 38) chain A residue 154 type sequence K description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 39) chain A residue 155 type sequence G description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 40) chain A residue 171 type sequence Y description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 41) chain A residue 172 type sequence K description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 42) chain A residue 173 type sequence S description BINDING SITE FOR RESIDUE EDO A 1224 source : BC9 43) chain A residue 119 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 44) chain A residue 148 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 45) chain A residue 154 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 46) chain A residue 166 type BINDING sequence S description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 171 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 190 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links