eF-site ID 2wld-A PDB Code 2wld Chain A click to enlarge Title Crystallographic analysis of the polysialic acid O-acetyltransferase OatWY Classification TRANSFERASE Compound POLYSIALIC ACID O-ACETYLTRANSFERASE Source null (Q93S40_NEIME) Sequence A:  MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCK IVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQA KTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIY SLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVV GSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTM YDDPTLNEFY Description (1)  POLYSIALIC ACID O-ACETYLTRANSFERASE Functional site 1) chain A residue 36 type sequence S description BINDING SITE FOR RESIDUE ACT A 1215 source : AC2 2) chain A residue 59 type sequence L description BINDING SITE FOR RESIDUE ACT A 1215 source : AC2 3) chain A residue 60 type sequence F description BINDING SITE FOR RESIDUE ACT A 1215 source : AC2 4) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE ACT A 1215 source : AC2 5) chain A residue 83 type sequence Q description BINDING SITE FOR RESIDUE ACT A 1215 source : AC2 6) chain A residue 147 type sequence G description BINDING SITE FOR RESIDUE EDO A 1216 source : AC3 7) chain A residue 69 type sequence G description BINDING SITE FOR RESIDUE EDO A 1217 source : AC4 8) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE EDO A 1217 source : AC4 9) chain A residue 90 type sequence N description BINDING SITE FOR RESIDUE EDO A 1217 source : AC4 10) chain A residue 8 type sequence E description BINDING SITE FOR RESIDUE EDO A 1218 source : AC6 11) chain A residue 13 type sequence N description BINDING SITE FOR RESIDUE EDO A 1218 source : AC6 12) chain A residue 14 type sequence T description BINDING SITE FOR RESIDUE EDO A 1218 source : AC6 13) chain A residue 15 type sequence I description BINDING SITE FOR RESIDUE EDO A 1218 source : AC6 14) chain A residue 75 type sequence H description BINDING SITE FOR RESIDUE EDO A 1219 source : AC7 15) chain A residue 97 type sequence E description BINDING SITE FOR RESIDUE EDO A 1219 source : AC7 16) chain A residue 119 type sequence D description BINDING SITE FOR RESIDUE EDO A 1220 source : AC9 17) chain A residue 133 type sequence N description BINDING SITE FOR RESIDUE EDO A 1220 source : AC9 18) chain A residue 154 type sequence K description BINDING SITE FOR RESIDUE EDO A 1220 source : AC9 19) chain A residue 154 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 166 type BINDING sequence S description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 171 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 190 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 119 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 148 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19525232 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links