eF-site ID 2wk1-A PDB Code 2wk1 Chain A click to enlarge Title Structure of the O-methyltransferase NovP Classification TRANSFERASE Compound NOVP Source null (Q9L9F2_STRSH) Sequence A:  DSSLYLDLMIKVLAGTVYEDPAHRETYREEVRNEGRDWPA NAHTMIGIKRLENIRQCVEDVIGNNVPGDLVETGVWRGGA CILMRGILRAHDVRDRTVWVADSFQGIPDVGEDGYAGDRK MALHRRNSVLAVSEEEVRRNFRNYDLLDEQVRFLPGWFKD TLPTAPIDTLAVLRMDGDLYESTWDTLTNLYPKVSVGGYV IVDDYMMCPPCKDAVDEYRAKFDIADELITIDRDGVYWQR TR Description Functional site 1) chain A residue 64 type sequence T description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 2) chain A residue 65 type sequence M description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 3) chain A residue 66 type sequence I description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 4) chain A residue 92 type sequence E description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 5) chain A residue 94 type sequence G description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 6) chain A residue 95 type sequence V description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 7) chain A residue 96 type sequence W description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 8) chain A residue 100 type sequence A description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 9) chain A residue 122 type sequence D description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 10) chain A residue 123 type sequence S description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 11) chain A residue 126 type sequence G description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 12) chain A residue 128 type sequence P description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 13) chain A residue 150 type sequence L description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 14) chain A residue 176 type sequence G description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 15) chain A residue 177 type sequence W description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 16) chain A residue 178 type sequence F description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 17) chain A residue 196 type sequence D description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 18) chain A residue 197 type sequence G description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 19) chain A residue 198 type sequence D description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 20) chain A residue 202 type sequence S description BINDING SITE FOR RESIDUE SAH A 301 source : AC1 21) chain A residue 87 type sequence P description BINDING SITE FOR RESIDUE SO4 A 401 source : AC2 22) chain A residue 144 type sequence H description BINDING SITE FOR RESIDUE SO4 A 401 source : AC2 23) chain A residue 145 type sequence R description BINDING SITE FOR RESIDUE SO4 A 401 source : AC2 24) chain A residue 56 type sequence R description BINDING SITE FOR RESIDUE SO4 A 451 source : AC3 25) chain A residue 253 type sequence R description BINDING SITE FOR RESIDUE SO4 A 451 source : AC3 26) chain A residue 195 type sequence M description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 27) chain A residue 196 type sequence D description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 28) chain A residue 197 type sequence G description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 29) chain A residue 203 type sequence T description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 30) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 31) chain A residue 224 type sequence D description BINDING SITE FOR RESIDUE EDO A 551 source : AC4 32) chain A residue 72 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 64 type BINDING sequence T description BINDING => ECO:0000269|PubMed:19857499 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 92 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19857499 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 122 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19857499 source Swiss-Prot : SWS_FT_FI2 36) chain A residue 178 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19857499 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 202 type BINDING sequence S description BINDING => ECO:0000269|PubMed:19857499 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 196 type BINDING sequence D description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 39) chain A residue 223 type BINDING sequence D description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 40) chain A residue 224 type BINDING sequence D description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links