eF-site ID 2wio-A PDB Code 2wio Chain A click to enlarge Title Structure of the histidine tagged, open cytochrome P450 Eryk from S. erythraea Classification OXIDOREDUCTASE Compound ERYTHROMYCIN B/D C-12 HYDROXYLASE Source Saccharopolyspora erythraea (strain NRRL 23338) (CPXQ_SACEN) Sequence A:  DEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRHAD VQTVLRDTATFSSDPTRVIEGASPTPGMIHEIDPPEHRAL RKVVSSAFTPRTISDLEPRIRDVTRSLLADAGESFDLVDV LAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQMDDPT DPALAERIADVLNPLTAYLKARCAERRADPGDDLISRLVL AEVDGRALDDEEAANFSTALLLAGHITTTVLLGNIVRTLD EHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQMQRTTTKA TEVAGVPIPADVMVNTWVLSANRDSDAHDDPDRFDPSRKS GGAAQLSFGHGVHFCLGAPLARLENRVALEEIIARFGRLT VDRDDERLRHFEQIVLGTRHLPVLAGSSPRQSA Description Functional site 1) chain A residue 87 type sequence I description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 2) chain A residue 88 type sequence H description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 4) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 5) chain A residue 106 type sequence F description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 6) chain A residue 238 type sequence L description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 7) chain A residue 241 type sequence A description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 8) chain A residue 242 type sequence G description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 9) chain A residue 245 type sequence T description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 10) chain A residue 246 type sequence T description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 11) chain A residue 249 type sequence L description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 12) chain A residue 288 type sequence F description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 13) chain A residue 293 type sequence R description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 14) chain A residue 345 type sequence S description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 15) chain A residue 346 type sequence F description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 16) chain A residue 347 type sequence G description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 17) chain A residue 351 type sequence H description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 18) chain A residue 353 type sequence C description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 19) chain A residue 355 type sequence G description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 20) chain A residue 358 type sequence L description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 21) chain A residue 359 type sequence A description BINDING SITE FOR RESIDUE HEM A 1412 source : AC1 22) chain A residue 346-355 type prosite sequence FGHGVHFCLG description CYTOCHROME_P450 Cytochrome P450 cysteine heme-iron ligand signature. FGhGVHFCLG source prosite : PS00086 23) chain A residue 88 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 95 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 292 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 293 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 351 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain A residue 353 type BINDING sequence C description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links