eF-site ID 2wio-A
PDB Code 2wio
Chain A

click to enlarge
Title Structure of the histidine tagged, open cytochrome P450 Eryk from S. erythraea
Classification OXIDOREDUCTASE
Compound ERYTHROMYCIN B/D C-12 HYDROXYLASE
Source Saccharopolyspora erythraea (strain NRRL 23338) (CPXQ_SACEN)
Sequence A:  DEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRHAD
VQTVLRDTATFSSDPTRVIEGASPTPGMIHEIDPPEHRAL
RKVVSSAFTPRTISDLEPRIRDVTRSLLADAGESFDLVDV
LAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQMDDPT
DPALAERIADVLNPLTAYLKARCAERRADPGDDLISRLVL
AEVDGRALDDEEAANFSTALLLAGHITTTVLLGNIVRTLD
EHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQMQRTTTKA
TEVAGVPIPADVMVNTWVLSANRDSDAHDDPDRFDPSRKS
GGAAQLSFGHGVHFCLGAPLARLENRVALEEIIARFGRLT
VDRDDERLRHFEQIVLGTRHLPVLAGSSPRQSA
Description (1)  ERYTHROMYCIN B/D C-12 HYDROXYLASE (E.C.1.14.-.-)


Functional site

1) chain A
residue 87
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

2) chain A
residue 88
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

3) chain A
residue 95
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

4) chain A
residue 99
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

5) chain A
residue 106
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

6) chain A
residue 238
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

7) chain A
residue 241
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

8) chain A
residue 242
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

9) chain A
residue 245
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

10) chain A
residue 246
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

11) chain A
residue 249
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

12) chain A
residue 288
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

13) chain A
residue 293
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

14) chain A
residue 345
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

15) chain A
residue 346
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

16) chain A
residue 347
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

17) chain A
residue 351
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

18) chain A
residue 353
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

19) chain A
residue 355
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

20) chain A
residue 358
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

21) chain A
residue 359
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM A 1412
source : AC1

22) chain A
residue 373
type METAL
ligand
sequence R
description Iron (heme axial ligand) (By similarity)
source Swiss-Prot : SWS_FT_FI1

23) chain A
residue 346-355
type prosite
ligand
sequence FGHGVHFCLG
description Cytochrome P450 cysteine heme-iron ligand signature. [FW]-[SGNH]-x-[GD]-{F}-[RKHPT]-{P}-C-[LIVMFAP]-[GAD]
source prosite : PS00086

24) chain A
residue 71
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence S
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

25) chain A
residue 87-88
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence IH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

26) chain A
residue 95
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

27) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

28) chain A
residue 106
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

29) chain A
residue 234
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

30) chain A
residue 238
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

31) chain A
residue 241-242
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AG
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

32) chain A
residue 245-246
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TT
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

33) chain A
residue 249
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

34) chain A
residue 282
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

35) chain A
residue 287-288
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

36) chain A
residue 291
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

37) chain A
residue 293
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

38) chain A
residue 345-347
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SFG
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

39) chain A
residue 350-356
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence VHFCLGA
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

40) chain A
residue 358-359
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence LA
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

41) chain A
residue 363
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence N
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2wio_A_1412

42) chain A
residue 245
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1akd
source CSA : CSA1

43) chain A
residue 244
type catalytic
ligand
sequence I
description Annotated By Reference To The Literature 1akd
source CSA : CSA1


Display surface

Download
Links