eF-site ID 2wi4-A
PDB Code 2wi4
Chain A

click to enlarge
Title Orally Active 2-Amino Thienopyrimidine Inhibitors of the Hsp90 Chaperone
Classification CHAPERONE
Compound HEAT SHOCK PROTEIN, HSP 90-ALPHA
Source Homo sapiens (Human) (HS90A_HUMAN)
Sequence A:  EVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDA
LDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTG
IGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG
VGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTD
TGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIG
YPITLFVEK
Description (1)  HEAT SHOCK PROTEIN, HSP 90-ALPHA


Functional site

1) chain A
residue 51
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

2) chain A
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

3) chain A
residue 55
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

4) chain A
residue 61
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

5) chain A
residue 93
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

6) chain A
residue 98
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

7) chain A
residue 102
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

8) chain A
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

9) chain A
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

10) chain A
residue 184
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ZZ4 A 1224
source : AC1

11) chain A
residue 51
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI1

12) chain A
residue 93
type BINDING
ligand
sequence D
description ATP.
source Swiss-Prot : SWS_FT_FI1

13) chain A
residue 138
type BINDING
ligand
sequence F
description ATP; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI2

14) chain A
residue 112
type BINDING
ligand
sequence K
description ATP (By similarity).
source Swiss-Prot : SWS_FT_FI3

15) chain A
residue 38-47
type prosite
ligand
sequence YSNKEIFLRE
description Heat shock hsp90 proteins family signature. Y-x-[NQHD]-[KHR]-[DE]-[IVA]-F-[LM]-R-[ED]
source prosite : PS00298

16) chain A
residue 48
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence L
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

17) chain A
residue 51-52
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence NS
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

18) chain A
residue 55
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence A
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

19) chain A
residue 93
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence D
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

20) chain A
residue 96-98
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence IGM
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

21) chain A
residue 102
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence D
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

22) chain A
residue 106-107
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence NL
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

23) chain A
residue 138-139
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence FY
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

24) chain A
residue 150
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence V
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

25) chain A
residue 184
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence T
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224

26) chain A
residue 186
type binding
ligand ZZ4: 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE
sequence V
description 4-(2,4-DICHLOROPHENYL)-5-PHENYLDIAZENYL-PYRIMIDIN-2-AMINE binding site
source pdb_hetatom : ZZ4_2wi4_A_1224


Display surface

Download
Links