eF-site ID 2wgm-v PDB Code 2wgm Chain v click to enlarge Title Complete ion-coordination structure in the rotor ring of Na-dependent F-ATP synthase Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C, SODIUM ION SPECIFIC Source ORGANISM_SCIENTIFIC: ILYOBACTER TARTARICUS; Sequence v:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain v residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA v 201 source : EC1 2) chain v residue 65 type sequence E description BINDING SITE FOR RESIDUE NA v 201 source : EC1 3) chain v residue 63 type sequence V description BINDING SITE FOR RESIDUE NA l 201 source : EC4 4) chain v residue 66 type sequence S description BINDING SITE FOR RESIDUE NA l 201 source : EC4 5) chain v residue 5 type sequence F description BINDING SITE FOR RESIDUE F09 u 314 source : GC7 6) chain v residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 7) chain v residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 8) chain v residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 9) chain v residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 10) chain v residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 11) chain v residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4

Display surface Download Links