eF-site ID 2wgm-d PDB Code 2wgm Chain d click to enlarge Title Complete ion-coordination structure in the rotor ring of Na-dependent F-ATP synthase Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C, SODIUM ION SPECIFIC Source ORGANISM_SCIENTIFIC: ILYOBACTER TARTARICUS; Sequence d:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain d residue 5 type sequence F description BINDING SITE FOR RESIDUE F09 c 314 source : AC9 2) chain d residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA d 201 source : BC5 3) chain d residue 65 type sequence E description BINDING SITE FOR RESIDUE NA d 201 source : BC5 4) chain d residue 63 type sequence V description BINDING SITE FOR RESIDUE NA e 201 source : BC8 5) chain d residue 66 type sequence S description BINDING SITE FOR RESIDUE NA e 201 source : BC8 6) chain d residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 7) chain d residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 8) chain d residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 9) chain d residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4 10) chain d residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 11) chain d residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links