eF-site ID 2wgm-c PDB Code 2wgm Chain c click to enlarge Title Complete ion-coordination structure in the rotor ring of Na-dependent F-ATP synthase Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C, SODIUM ION SPECIFIC Source ORGANISM_SCIENTIFIC: ILYOBACTER TARTARICUS; Sequence c:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain c residue 5 type sequence F description BINDING SITE FOR RESIDUE F09 b 314 source : AC5 2) chain c residue 13 type sequence A description BINDING SITE FOR RESIDUE F09 b 314 source : AC5 3) chain c residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA c 201 source : BC2 4) chain c residue 65 type sequence E description BINDING SITE FOR RESIDUE NA c 201 source : BC2 5) chain c residue 63 type sequence V description BINDING SITE FOR RESIDUE NA d 201 source : BC5 6) chain c residue 66 type sequence S description BINDING SITE FOR RESIDUE NA d 201 source : BC5 7) chain c residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 8) chain c residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 9) chain c residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 10) chain c residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4 11) chain c residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 12) chain c residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links