eF-site ID 2wfk-B
PDB Code 2wfk
Chain B

click to enlarge
Title Calcium bound LipL32
Classification METAL BINDING PROTEIN
Compound LIPL32
Source Leptospira santarosai (Q6S9S1_9LEPT)
Sequence B:  GGLPSLKSSFVLSESTVPGTNETVKTFLPYGSVINYYGYV
KPGQAPDGLVDGNKKAYYLYVWIPAVIAEXGVRXISPTGE
IGEPGDGDLVSDAFKAATPEEKSXPHWFDTWIRVERXSAI
XPDQIAKAAKAKPVQKLDDDDDGDDTYKEERHNKYNSLTR
IKIPTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPP
GIPGVSPLIHSNPEELQKQAIAAEESLKKAASD
Description (1)  LIPL32


Functional site

1) chain B
residue 113
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 1250
source : AC2

2) chain B
residue 114
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CA B 1250
source : AC2

3) chain B
residue 145
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 1250
source : AC2

4) chain B
residue 146
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 1250
source : AC2

5) chain B
residue 159
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CA B 1250
source : AC2


Display surface

Download
Links