eF-site ID 2wdt-A PDB Code 2wdt Chain A click to enlarge Title Crystal structure of Plasmodium falciparum UCHL3 in complex with the suicide inhibitor UbVME Classification HYDROLASE/PROTEIN BINDING Compound UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3 Source (2WDT) Sequence A:  DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDM IPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYG NLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIE NLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRK DHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALA VIPN Description Functional site 1) chain A residue 92 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:20042598 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 164 type ACT_SITE sequence H description Proton donor => ECO:0000250|UniProtKB:P09936 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 33 type SITE sequence D description Interaction with ubiquitin => ECO:0000269|PubMed:20042598 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 157 type SITE sequence D description Interaction with ubiquitin => ECO:0000269|PubMed:20042598 source Swiss-Prot : SWS_FT_FI3 5) chain A residue 219 type SITE sequence S description Interaction with ubiquitin => ECO:0000269|PubMed:20042598 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 179 type SITE sequence D description Important for enzyme activity => ECO:0000250|UniProtKB:P09936 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links