eF-site ID 2wbq-A PDB Code 2wbq Chain A click to enlarge Title Crystal structure of VioC in complex with (2S,3S)-hydroxyarginine Classification OXIDOREDUCTASE Compound L-ARGININE BETA-HYDROXYLASE Source Streptomyces vinaceus (Q6WZB0_STRVI) Sequence A:  VRPWSEFRLTPAEAAAAAALAARCAQRYDETDGPEFLLDA PVIAHELPKRLRTFMARARLDAWPHALVVRGNPVDDAALG STPVHWRTARTPGSRPLSFLLMLYAGLLGDVFGWATQQDG RVVTDVLPIKGGEHTLVSSSSRQELGWHTEDAFSPYRADY VGLLSLRNPDGVATTLAGVPLDDLDERTLDVLFQERFLIR PDDSHLQVNNSGRVEFEGIAQAADRPEPVAILTGHRAAPH LRVDGDFSAPAEGDEEAAAALGTLRKLIDASLYELVLDQG DVAFIDNRRAVHGRRAFQPRYDGRDRWLKRINITRDLHRS RKAWAGDSRVLG Description Functional site 1) chain A residue 146 type sequence V description BINDING SITE FOR RESIDUE ACT A 1357 source : AC1 2) chain A residue 194 type sequence T description BINDING SITE FOR RESIDUE ACT A 1357 source : AC1 3) chain A residue 318 type sequence R description BINDING SITE FOR RESIDUE ACT A 1357 source : AC1 4) chain A residue 330 type sequence R description BINDING SITE FOR RESIDUE ACT A 1357 source : AC1 5) chain A residue 332 type sequence L description BINDING SITE FOR RESIDUE ACT A 1357 source : AC1 6) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 7) chain A residue 156 type sequence L description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 8) chain A residue 157 type sequence V description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 9) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 10) chain A residue 165 type sequence L description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 11) chain A residue 168 type sequence H description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 12) chain A residue 170 type sequence E description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 13) chain A residue 222 type sequence D description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 14) chain A residue 224 type sequence S description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 15) chain A residue 268 type sequence D description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 16) chain A residue 270 type sequence D description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 17) chain A residue 334 type sequence R description BINDING SITE FOR RESIDUE ZZU A 1358 source : AC2 18) chain A residue 156 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 168 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 170 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 194 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 268 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 316 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 330 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 334 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 117-135 type TRANSMEM sequence LSFLLMLYAGLLGDVFGWA description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links