eF-site ID 2war-A
PDB Code 2war
Chain A

click to enlarge
Title Hen Egg White Lysozyme E35Q chitopentaose complex
Classification HYDROLASE
Compound LYSOZYME C
Source (LYSC_CHICK)
Sequence A:  KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFQSNFNT
QATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPC
SALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDV
QAWIRGCRL
Description (1)  LYSOZYME C (E.C.3.2.1.17)


Functional site

1) chain A
residue 35
type
ligand
sequence Q
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

2) chain A
residue 46
type
ligand
sequence N
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

3) chain A
residue 57
type
ligand
sequence Q
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

4) chain A
residue 58
type
ligand
sequence I
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

5) chain A
residue 59
type
ligand
sequence N
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

6) chain A
residue 62
type
ligand
sequence W
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

7) chain A
residue 63
type
ligand
sequence W
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

8) chain A
residue 75
type
ligand
sequence L
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

9) chain A
residue 101
type
ligand
sequence D
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

10) chain A
residue 102
type
ligand
sequence G
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

11) chain A
residue 103
type
ligand
sequence N
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

12) chain A
residue 107
type
ligand
sequence A
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

13) chain A
residue 108
type
ligand
sequence W
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

14) chain A
residue 109
type
ligand
sequence V
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

15) chain A
residue 125
type
ligand
sequence R
description BINDING SITE FOR CHAIN A OF RESIDUES 1130 TO 1134
source : AC1

16) chain A
residue 76-94
type prosite
ligand
sequence CNIPCSALLSSDITASVNC
description Alpha-lactalbumin / lysozyme C signature. C-x(3)-C-x(2)-[LMF]-x(3)-[DEN]-[LI]-x(5)-C
source prosite : PS00128

17) chain A
residue 35
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Q
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

18) chain A
residue 45-46
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence RN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

19) chain A
residue 52
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence D
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

20) chain A
residue 56-57
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence LQ
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

21) chain A
residue 59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

22) chain A
residue 107-110
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AWVA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1134

23) chain A
residue 56-59
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence LQIN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1133

24) chain A
residue 61-63
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence RWW
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1133

25) chain A
residue 98
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence I
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1133

26) chain A
residue 107-109
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AWV
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1133

27) chain A
residue 62-63
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence WW
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1132

28) chain A
residue 101
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence D
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1132

29) chain A
residue 103
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1132

30) chain A
residue 62
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1131

31) chain A
residue 73
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1131

32) chain A
residue 75
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1131

33) chain A
residue 101-103
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence DGN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1131

34) chain A
residue 101-103
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence DGN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2war_A_1130


Display surface

Download
Links