eF-site ID 2w6i-C
PDB Code 2w6i
Chain C

click to enlarge
Title Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 4B.
Classification HYDROLASE
Compound ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
Source ORGANISM_COMMON: BOVINE; ORGANISM_SCIENTIFIC: BOS TAURUS;
Sequence C:  ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSG
LKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVP
VGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSI
AIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVK
RLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFR
DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDV
FYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYI
PTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA
QTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLL
SRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEP
SKITKFENAFLSHVISQHQALLSKIRTDGKISEESDAKLK
EIVTNFLAGFEA
Description (1)  ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL (E.C.3.6.3.14), ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL (E.C.3.6.3.14), ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL (E.C.3.6.3.14), F1-ATPASE DELTA SUBUNIT (E.C.3.6.3.14), ATP SYNTHASE SUBUNIT EPSILON, MITOCHONDRIAL (E.C.3.6.3.14)


Functional site

1) chain C
residue 373
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1ohh
source CSA : CSA3

2) chain C
residue 175
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ohh
source CSA : CSA12

3) chain C
residue 209
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ohh
source CSA : CSA12

4) chain C
residue 208
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ohh
source CSA : CSA12


Display surface

Download
Links