eF-site ID 2w5e-D PDB Code 2w5e Chain D click to enlarge Title Structural and biochemical analysis of human pathogenic astrovirus serine protease at 2.0 Angstrom resolution Classification HYDROLASE Compound PUTATIVE SERINE PROTEASE Source Human astrovirus-1 (HAstV-1) (Q3ZN04_HASV1) Sequence D:  KHHHHHHIKPGALCVIDTPEGKGTGFFSGNDIVTAAHVVG NNTFVNVCYEGLMYEAKVRYMPEKDIAFITCPGDLHPTAR LKLSKNPDYSCVTVMAYVNEDLVVSTAAAMVYGNTLSYAV RTQDGMSGAPVCDKYCRVLAVHQTNTGYTGGAVIIDPTDF HP Description Functional site 1) chain D residue 474 type sequence E description BINDING SITE FOR RESIDUE CD C 1587 source : BC6 2) chain D residue 472 type sequence C description BINDING SITE FOR RESIDUE CL C 1591 source : CC1 3) chain D residue 472 type sequence C description BINDING SITE FOR RESIDUE CD C 1592 source : CC2 4) chain D residue 439 type sequence V description BINDING SITE FOR RESIDUE CL D 1587 source : CC3 5) chain D residue 446 type sequence K description BINDING SITE FOR RESIDUE CL D 1587 source : CC3 6) chain D residue 472 type sequence C description BINDING SITE FOR RESIDUE CL D 1587 source : CC3 7) chain D residue 433 type sequence K description BINDING SITE FOR RESIDUE CL D 1588 source : CC4 8) chain D residue 434 type sequence P description BINDING SITE FOR RESIDUE CL D 1588 source : CC4 9) chain D residue 435 type sequence G description BINDING SITE FOR RESIDUE CL D 1588 source : CC4 10) chain D residue -2 type sequence H description BINDING SITE FOR RESIDUE CD D 1589 source : CC5 11) chain D residue -4 type sequence H description BINDING SITE FOR RESIDUE CD D 1589 source : CC5 12) chain D residue -3 type sequence H description BINDING SITE FOR RESIDUE CL D 1590 source : CC6 13) chain D residue -5 type sequence H description BINDING SITE FOR RESIDUE CD D 1591 source : CC7 14) chain D residue -3 type sequence H description BINDING SITE FOR RESIDUE CD D 1591 source : CC7 15) chain D residue 515 type sequence C description BINDING SITE FOR RESIDUE CD D 1591 source : CC7 16) chain D residue 514 type sequence S description BINDING SITE FOR RESIDUE CL D 1592 source : CC8 17) chain D residue 515 type sequence C description BINDING SITE FOR RESIDUE CL D 1592 source : CC8 18) chain D residue -6 type sequence H description BINDING SITE FOR RESIDUE CD C 1594 source : DC1 19) chain D residue -6 type sequence H description BINDING SITE FOR RESIDUE CL D 1593 source : DC2 20) chain D residue 500 type sequence H description BINDING SITE FOR RESIDUE CL F 1589 source : EC3 21) chain D residue 500 type sequence H description BINDING SITE FOR RESIDUE CD F 1590 source : EC4 22) chain D residue 461 type ACT_SITE sequence H description Charge relay system; for serine protease activity => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 23) chain D residue 489 type ACT_SITE sequence D description Charge relay system; for serine protease activity => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 24) chain D residue 551 type ACT_SITE sequence S description Charge relay system; for serine protease activity => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links